(data stored in ACNUC7421 zone)

EMBL: CP000271.PE627

CP000271.PE627       Location/Qualifiers
FT   CDS_pept        730668..730991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33595"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP4"
FT                   /protein_id="ABE33595.1"
FT                   /translation="MMRLRCLLARLGGLCRGSDSRYNRPRRSRTGRPASWLRAMRGRHR
FT                   NAVGQTRSREVIAAGQARKGEDSDSFASRRASFRCSSVQMNDGASQRIAGPAKYPEAAL
FT                   KRC"
     gtgatgcgct tgcggtgcct gcttgcgcgc cttggcgggc tctgccgtgg atcggacagt        60
     cgatacaacc ggccgcgtcg cagccgtact ggccggccgg cttcgtggct gcgagcgatg       120
     cgcggacgcc atcgcaacgc ggtcgggcaa acgcggtccc gagaagtcat agccgccggg       180
     caggcgagaa agggagagga tagtgattcc tttgcgagca ggcgagcgtc gttcaggtgt       240
     tcaagtgttc agatgaatga cggtgccagt cagcgtatcg ccggtcccgc gaaatatcct       300
     gaagccgcgc tgaaacgttg ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page