(data stored in ACNUC7421 zone)

EMBL: CP000271.PE633

CP000271.PE633       Location/Qualifiers
FT   CDS_pept        736048..737928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2388"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33601"
FT                   /db_xref="GOA:Q13QN8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN8"
FT                   /protein_id="ABE33601.1"
FT                   /translation="MRFAMNSSTSGLTPAEVVFFNGKIATQDDRRSFADSLAVANGRVL
FT                   AAGSRETVMRHANDNTRHVDLKGRTVIPGLNDSHLHIIRGGLNFNMELRWDGVPSLADA
FT                   LDMLRKQVARTPAPQWVRVVGGWNEFQFAERRGPTLEEINAIAPDTPVFILHLYDSALL
FT                   NAAALRAVGYTKDTPNPPGGEIQRDKRGNPTGMLIARPNAGLLYATLAKGPKLAPEDQR
FT                   NSTRHFMRELNRLGVTSAIDAGGGYQAYPDDYAVIVEMAKHSELTVRIAYNLFTQNAKK
FT                   EIEDFAKWVKMTRPGEGDDFLRVNGAGEMLVFSAADFEDFLEPRPDLPESLETELEAVV
FT                   RLLVANRWPFRLHATYNESIERFLNVFERVNAEIPFNGLRWFFDHCETITQQNIERVKA
FT                   LGGGIAIQHRMAYQGEYFIHQYGEEAVKRTPPVRHMLDAGLPVGAGTDATRVASFNPFV
FT                   SLYWMVSGKTVGGTAMYGSENRLDRMEALRRYTVGSAWFSNEEEKKGALVPGQFADFAV
FT                   LSEDFFSIDESRIKYLTSNMTVVGGKVVYADDEFAPLAPPDLPVSPSWSPVAEFGGYSR
FT                   YKPTAVACVDGCVNLCGVHAHAHGWAWRKNVPVSDSNGFWGALGCSCFAF"
     atgaggttcg ccatgaattc cagtacttcc ggattgacgc cggccgaggt cgtgttcttc        60
     aacggcaaga tcgccaccca ggacgacagg cgctcattcg ccgattcgct tgccgtcgcg       120
     aacggccgcg tgcttgccgc gggttcgcgc gagacggtga tgcgtcacgc aaacgacaac       180
     acgcgccatg tcgacctcaa agggcgcacg gtgattcccg gtctcaacga ttcgcatctg       240
     cacatcattc gcggtggcct gaacttcaat atggagttgc gctgggacgg cgtgccgtcg       300
     ctcgccgacg cgctcgacat gctgcgcaaa caggtcgcgc gcacgccggc gccgcagtgg       360
     gtgcgggtag tgggcggctg gaacgaattc cagttcgccg agcggcgcgg cccgacgctc       420
     gaagaaatca atgcgatcgc gccggacacg ccggtgttca tcctgcatct gtacgacagc       480
     gcgctgctga atgcggcggc gctgcgcgcg gtcggctata ccaaagacac cccgaacccg       540
     ccgggcggcg agatccagcg cgacaagcgc ggcaacccga ccggcatgct gatcgcgcgg       600
     cccaacgccg gcctgctgta cgcgacgctc gcaaaaggcc cgaagctcgc gccggaagac       660
     cagcgcaatt ccacccgcca tttcatgcgc gagctgaacc gcctcggcgt gacgagcgcg       720
     atcgacgcgg gcggcggcta ccaggcttat cccgacgact acgcggtcat cgtggagatg       780
     gcgaagcaca gcgaactgac cgtccggatc gcctacaacc tgttcacgca gaacgcgaag       840
     aaggaaatcg aagacttcgc caaatgggtg aagatgacca gaccgggcga aggcgacgat       900
     ttcctgcgcg tgaacggcgc gggggagatg ctggtgttct ccgccgcgga cttcgaagac       960
     tttctcgagc cgcgcccgga cctgcccgag tcgctggaga ccgaactgga ggcggtcgtc      1020
     aggctgctgg tggcgaaccg ctggccgttc cggctgcacg ccacttacaa cgaatcgatc      1080
     gagcgcttcc tgaacgtgtt cgaacgcgtg aacgccgaga ttccgttcaa cggcctgcgc      1140
     tggttcttcg atcactgcga gaccatcacg cagcagaaca tcgagcgggt gaaggcgctc      1200
     ggcggcggca ttgcgatcca gcaccggatg gcgtatcagg gcgagtactt cattcatcaa      1260
     tacggcgaag aggctgtcaa gcgtacgccg ccggtccgcc acatgctcga cgccgggctg      1320
     ccggtcggcg cgggtacgga cgccacgcgc gtcgcgagct tcaacccgtt cgtgtcgctg      1380
     tactggatgg tgtcgggcaa gacagtgggc ggcaccgcca tgtacggcag cgaaaacaga      1440
     ctcgaccgta tggaagcgtt gcgccgctac acggtgggca gcgcatggtt ctcgaacgaa      1500
     gaggaaaaga agggcgcgct ggtgccgggc cagttcgccg acttcgcggt gctgagcgaa      1560
     gacttcttca gcatcgacga aagccgcatc aaatacctga cctcgaacat gacggtggtg      1620
     ggcggcaagg tcgtctatgc ggacgacgaa ttcgcgccgc tcgcgccgcc cgatctgccg      1680
     gtcagcccgt cgtggtcgcc ggtggcggag ttcggcggct acagccgcta caagccgacg      1740
     gcggtggcat gcgtggacgg ctgcgtgaac ctgtgcggcg tgcatgccca cgcgcacggc      1800
     tgggcatggc gcaagaacgt gccggtcagc gattcgaacg gcttctgggg cgcgttggga      1860
     tgtagctgct tcgcgttctg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page