(data stored in ACNUC7421 zone)

EMBL: CP000271.PE635

CP000271.PE635       Location/Qualifiers
FT   CDS_pept        739632..740273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2386"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33603"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN6"
FT                   /protein_id="ABE33603.1"
FT                   /translation="MKKTIAGVDIPDGVMAQAATDLIRGTESELMFHHALRAFLFAALT
FT                   GYRENLTFDAQLLYVGAMFHNVGLNAKYERSPYRFEVDGANAARDFLRRHGVAEREIEE
FT                   VWVGIALHTTPGIPEHLSALVALISAGVQMDVRGARYDEFTAHQRDEIVQAYPRESGFK
FT                   KKLIEAYAHGMEHRPETTFGTVNADVLDRWDPNYRRLNFCGLVLGSDWPN"
     atgaagaaga ccattgccgg cgttgacatc cccgacggtg tcatggccca ggcggcgact        60
     gacctgattc gcggcacgga gtctgagctg atgtttcatc acgcgttgcg cgccttcctg       120
     ttcgccgcgc tgaccggata ccgcgagaac ctgacgttcg acgcgcaact gttgtatgtc       180
     ggggcgatgt ttcacaacgt cggcctgaac gcgaagtacg agcgctcgcc ataccgcttc       240
     gaggtggacg gcgccaacgc cgcgcgcgat tttctgcgcc ggcacggcgt cgccgagcgc       300
     gagatcgaag aggtctgggt ggggatcgcc ttgcacacga cccccggcat accggaacac       360
     ctgtcggcgc tggtcgcgct catcagcgcc ggtgtgcaga tggacgtgcg gggcgcgcgc       420
     tacgacgaat ttaccgcgca tcagcgggac gaaatcgtgc aggcctatcc gcgcgaatcc       480
     ggcttcaaga agaagctgat cgaagcatac gcgcacggca tggagcatcg tcccgagacg       540
     acgttcggga ccgtgaatgc cgatgtgctg gaccggtggg atccgaacta tcgccgactg       600
     aatttctgcg gactggtgct gggatcggac tggccgaatt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page