(data stored in ACNUC7421 zone)

EMBL: CP000271.PE637

CP000271.PE637       Location/Qualifiers
FT   CDS_pept        740617..741576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33605"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN4"
FT                   /protein_id="ABE33605.1"
FT                   /translation="MDIQMFKSLHRYRAIALVSAALLIGSTAASSAFADAGPPEVSSGK
FT                   TALVKHPDVSVGAQYDTTHVYVASADLDAFVNSFLATFGGKASPRAVFTVTPTPSKTAS
FT                   QYVQTPVGMLSVFGFETPIPYPFGNERTGYLVTDIDQGVKAARAAGADVLVESFDDPIG
FT                   KDAIIQWPGGLTMQLYWHTKAPNYAPLQSVPDNRVYVSRYEANNFVRRWLHFSHGKVVS
FT                   DNPRADAGVIGRPGETIREIRIASGFGRMIVFVTDGKLPFPFGRETTGYNVDDVAQTLE
FT                   RAQAAGAKVLYPAYAVGSGKTAMLEFPGGYIAEVHDGK"
     atggatattc aaatgttcaa gtcgcttcat agataccgcg ccattgcgct cgtttccgcc        60
     gcgttgctga tcggctcgac ggcggcttcg tcggccttcg ccgatgcggg gccgccggaa       120
     gtgtcgagtg gcaagaccgc gctggtgaaa cacccggacg tgtcggtggg cgcgcagtac       180
     gacaccaccc atgtgtacgt cgcctcggcc gacctcgatg cgttcgtcaa cagctttctc       240
     gcgaccttcg gcggcaaggc ctcgccgcgc gcggtcttca ccgtgacgcc gacgccgagc       300
     aagaccgcct cgcaatatgt gcagacgccg gtcggcatgc tgtcggtgtt cggcttcgag       360
     acgccaattc cgtatccgtt cggcaatgaa cgcaccggct acctcgtcac ggacatcgat       420
     cagggcgtga aagcggcgcg cgccgccggc gccgacgtgc tggtcgagtc gttcgacgat       480
     ccgatcggca aggacgcgat cattcaatgg ccgggcgggc tgaccatgca gctctactgg       540
     cacaccaagg cgccgaatta cgcgccgttg caaagcgtgc ccgacaaccg cgtgtacgtg       600
     tcgcgttacg aagcgaacaa cttcgtgcgc cgctggctgc acttctcgca tggcaaggtg       660
     gtgtcggaca atccgcgcgc ggacgccggc gtgatcggcc ggccaggcga aacgattcgc       720
     gagatccgca tcgcgtcggg cttcggccgc atgatcgtgt tcgtgacgga cggcaagctg       780
     ccgttcccgt tcggacgtga gaccaccggc tacaacgtgg acgacgtggc gcagacgctg       840
     gagcgcgcgc aggcggccgg cgcgaaggtg ttgtatccgg catatgcggt cggatcgggc       900
     aagaccgcga tgctcgaatt cccgggcggg tacattgccg aagtgcacga tggcaagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page