(data stored in ACNUC7421 zone)

EMBL: CP000271.PE638

CP000271.PE638       Location/Qualifiers
FT   CDS_pept        741584..743092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33606"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN3"
FT                   /protein_id="ABE33606.1"
FT                   /translation="MVPSFTLRRARRRARHAIRALLLSTGLAAALPAAAADTALGGADD
FT                   TSTTGSPAAATTAAGAAAASCARPAIMFNRWQENWSVLANPCVPKKPFDSLKYIPLFGN
FT                   PDAYISLGMVLRERLEINDAPLFGLGAQHDDTYLLQRLEVHADVRLGPHVQIFTQFEDA
FT                   QPYGKDVVTPVDKNPLDLRQAFVAITEPLGPGTVKFRVGRQEMAFDLQRFVSVRDGPNV
FT                   RQAFDAIWADYETGPWRWIAYATQPVQYRDNSDFDDVSNRDLTFSGVRVERKNVGPGDL
FT                   SAYYSRYNRSNAKFLDASGDEHRDVFDARYAGNVAPIDWDVEAMYQSGHVGNKTIGAWA
FT                   VGSLAGYTLASLPWTPRLGIQIDAASGDSHPGDGRIGTFNPLFPNGYYFALAGYTGYTN
FT                   LVHVKPTLILKPSSKLTLLAGVGLQWRQTTADAVYGQGSAVVPGTAGHGSPWTGFYTQL
FT                   RADYAVTANLAAALEAVHFQVGPSLRDLGARNADYVGAELKFGW"
     gtggtgccgt cgttcacgct gcggcgcgcg cgccggcggg cgcggcacgc catccgcgca        60
     ttgctgctca gtacggggct ggcggcggcg ctgccggccg cggcggcgga caccgcgctc       120
     ggcggcgcgg acgatacctc cacgaccggc agcccggcgg ccgccacgac cgctgccggg       180
     gctgccgcag cctcgtgcgc gcggcccgcg atcatgttca atcgctggca ggaaaactgg       240
     tcggtgctgg ccaatccctg cgtgccgaaa aagcccttcg attcgctgaa gtacattccg       300
     ctgttcggca atccggatgc gtatatctcg cttggcatgg tgctgcgcga acggctcgaa       360
     atcaacgacg cgccgctctt cggtctcggc gcgcaacacg acgacaccta cctgctgcaa       420
     cgtctcgaag ttcacgcgga cgtgcgcctc ggccctcacg tgcagatctt cacgcaattc       480
     gaagacgcgc agccgtatgg caaagacgtc gttacgccgg tcgacaagaa cccgctcgac       540
     ctgcgccagg cgttcgtcgc gattaccgag ccgctcgggc ccggcacggt gaagttccgc       600
     gtcggccgcc aggaaatggc gttcgacttg cagcgtttcg tttccgtgcg cgacggcccg       660
     aacgtgcgtc aggcgttcga cgcgatctgg gccgactatg aaaccggccc gtggcgctgg       720
     atcgcctacg cgacgcagcc ggtccaatac cgcgacaact cggatttcga cgatgtttcc       780
     aatcgcgatc tgactttcag cggcgtgcgc gtggagcgca agaacgtcgg gccgggcgac       840
     ctgtccgcgt actactcgcg ctataaccgc agcaacgcga agttcctcga cgcgagcggc       900
     gacgaacacc gcgacgtgtt cgacgcgcgc tacgccggca atgtcgcgcc gatcgactgg       960
     gatgtcgagg cgatgtatca gtccggccat gtcggcaaca agacgatcgg cgcgtgggcg      1020
     gtcggctcgc tggccggcta cacgctggcc tccctgccgt ggacgccgcg cctcggcatt      1080
     cagatcgatg ccgcctcggg cgacagtcat ccgggggacg ggcgcatcgg caccttcaat      1140
     ccgctctttc cgaacggcta ctacttcgcg ctggccggct ataccggcta cacgaacctg      1200
     gtgcacgtca agccgactct gatcctcaag cccagcagca agctcacgct gctggcgggc      1260
     gtcggtttgc agtggcgtca gaccaccgcg gacgccgtgt acggccaggg ttcggcggtc      1320
     gtgccgggaa cggcggggca cggcagcccg tggaccggct tctatacgca actgcgcgcc      1380
     gactatgcgg tcaccgccaa tctcgcggcg gcgctggaag ccgtgcattt tcaggtcggt      1440
     ccttcgctgc gcgatctggg cgcgcgcaac gccgactacg tgggcgccga actcaagttc      1500
     ggctggtag                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page