(data stored in SCRATCH zone)

EMBL: CP000271.PE64

CP000271.PE64        Location/Qualifiers
FT   CDS_pept        72953..74473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2963"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2963"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33032"
FT                   /db_xref="GOA:Q13SA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA7"
FT                   /protein_id="ABE33032.1"
FT                   /translation="MSELTPSAPVVEAFEITKRFGSTAALKDVSIRVMPGESHALVGRN
FT                   GAGKSTLVSILTGLRKPDTGEVRFSGVAAPSIADRDAWRERVACVYQHSTIIRDLSVAE
FT                   NLFINRQPLRGGMIDWQAMRRDARTLLDHWKIDVREDARAGDLTVEARQLVEIARALSY
FT                   GARFIILDEPTAQLDGDEIKRLFRRISELQREGVTFLFISHHLQEVYEICQAVTVLRDA
FT                   RHIVSAPVSALPREQLIEAMTGERGGLAVADAAARDALPADTAIALQVESLAGSDYEGV
FT                   SFTVKRGEVVGLTGATSSGRTSVAEAIAGLRAAKRGTIRVDGKTLPPGDVPAALAHGVG
FT                   CVPKDRHHEGLVLTQSVAENASMTIARLLGKFGIAPPAKKNAFGQKMIDALGIVAQGPE
FT                   HVVSGLSGGNQQKVVMARALATNPNVLVLIDPTAGVDVKSKEALLSVVDRVREDGKAVL
FT                   VVSGELDDLRTCDRVLVMFRGRVAAEFPAGWQDHDLIASVEGVSLHEE"
     atgagcgaac tcacgccctc cgcgcccgtt gtcgaagcgt tcgagatcac caagcgcttc        60
     ggctcgacgg ccgcgctgaa agacgtgagc atccgcgtga tgcccggcga gtcgcatgcg       120
     ctcgtcgggc gcaacggcgc gggtaaatcg acgctggtgt cgatcctcac cggcctgcgc       180
     aagcccgaca ccggcgaggt gcgtttcagc ggcgtggccg cgccgtcgat cgcggatcgc       240
     gacgcgtggc gcgaacgtgt ggcgtgcgtc tatcagcatt cgacgatcat ccgcgacctg       300
     agcgtcgcgg agaatctgtt tatcaaccgg cagccgttgc gcggcggcat gatcgattgg       360
     caggccatgc ggcgcgacgc gcgcacgttg ctcgatcact ggaagatcga cgtgcgcgaa       420
     gacgctcgcg ccggcgatct gacggtggag gcacggcaac tggtggaaat tgcgcgtgcg       480
     ctgtcgtatg gcgcgcgctt catcattctc gacgaaccga ccgcgcagct cgacggcgac       540
     gaaatcaagc gcctgttccg gcgtatcagc gagttgcagc gcgaaggcgt gacctttctg       600
     ttcatctcgc accatcttca ggaagtctat gaaatttgcc aggccgtgac ggtgctgcgc       660
     gacgcgcggc atatcgtcag cgcgccggtt tccgcgctgc cgcgcgagca gttgatcgaa       720
     gcgatgaccg gcgaacgcgg cggtctcgcc gtcgccgatg cggcggcgcg cgacgcgttg       780
     cccgccgaca cggcgattgc gctgcaagtc gagagcctcg cgggctccga ttacgaaggc       840
     gtgtcgttca ccgtcaagcg cggcgaagtg gtcggcttga ccggcgcaac gagcagcggc       900
     cgcacgagcg tggccgaagc gattgccggc ttgcgtgccg ccaaacgcgg cacgatccgt       960
     gtggacggca aaaccttgcc gcccggcgat gtgcccgcgg cgctcgcgca cggcgtcggc      1020
     tgtgtgccga aggatcgcca ccacgaaggc ctcgtgctca cgcaatcggt tgcggaaaac      1080
     gcctcgatga cgatcgcgcg tttgctcggc aagttcggca tcgcaccgcc cgcgaagaag      1140
     aacgccttcg gccagaaaat gatcgacgcg ctcggcatcg tcgcgcaggg tccggagcat      1200
     gtggtgtcgg ggctgtcggg cggcaatcag caaaaggtgg tgatggcgcg cgcgctcgcc      1260
     accaatccca atgtgctcgt gctgatcgac ccgacggcgg gcgtcgacgt gaaatcgaaa      1320
     gaagcgctgc tctccgtcgt ggaccgggtg cgcgaagacg gcaaggccgt gctggtcgtg      1380
     tccggcgaac tcgacgatct gcgcacctgt gaccgcgtgc tggtcatgtt ccgtggccgt      1440
     gtcgcggccg aatttcccgc gggttggcag gaccacgacc tgatcgcatc cgttgaagga      1500
     gtcagtctcc atgaagaata g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page