(data stored in ACNUC7421 zone)

EMBL: CP000271.PE644

CP000271.PE644       Location/Qualifiers
FT   CDS_pept        750442..750939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33612"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM7"
FT                   /protein_id="ABE33612.1"
FT                   /translation="MHSETCLTPRGEASREACCAPREPADASPDGLRSSVWDHVIHALL
FT                   PGYRGESGESGEASRERRTPRMAACVPSPHIQVEVIERLSETSVAVLWQDATRCRYDDQ
FT                   VWISCRARQKGYCALSGAVIRRDDLIYKPRVRASMPANAAAMILASVVEQMSALTTADD
FT                   AR"
     atgcatagcg aaacctgttt gacgccgcgc ggcgaggcca gccgggaagc atgttgcgca        60
     ccgcgcgagc cggccgacgc gtccccggac ggactgcgct cctcggtgtg ggatcacgtg       120
     attcacgctc tgttgccggg ctatcgcgga gaaagtggag aaagcggaga agcgtcccgc       180
     gagcggcgca cgcctcgcat ggccgcttgc gtgccgtcgc cgcatatcca ggtcgaggtg       240
     atcgagcgtc tgtccgaaac gtcggtcgcg gtgctctggc aggatgcgac ccgctgccgc       300
     tacgacgacc aggtgtggat cagttgccgc gcccgccaga agggctactg tgcgctgagc       360
     ggagcggtga tccggcgtga cgatctgatc tacaagccgc gagtgcgggc gagcatgccg       420
     gccaacgctg ccgcgatgat tctcgcctcc gtggtcgagc agatgtccgc cctgacgaca       480
     gcggacgatg cgcgttag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page