(data stored in ACNUC7421 zone)

EMBL: CP000271.PE648

CP000271.PE648       Location/Qualifiers
FT   CDS_pept        757413..757850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33616"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM3"
FT                   /protein_id="ABE33616.1"
FT                   /translation="MKAKWTLVFLAASAFGAVCQQATAQVAGAQPIGITVEQAQLVVEG
FT                   WSVKKSLLGKSIYNDSGEKVGVLHDIIVAPDNAVSFGIVAAHQFLGVSQHDVAVPMSQL
FT                   DYANGKLVWAGATREVVKSLPVFIYSKVRTVPIARKDYGHH"
     atgaaggcaa agtggacact cgtatttctg gcggcgtcgg cgttcggcgc ggtgtgccag        60
     caggcaaccg cacaggtagc gggcgcgcag ccgatcggca ttaccgtcga acaggcgcaa       120
     ctcgtcgtgg aaggctggag cgtcaagaag agcctgctcg gcaagagcat ctacaacgac       180
     agcggcgaga aagtcggcgt gcttcacgac atcatcgtcg cgccggacaa cgccgtttcc       240
     ttcgggatcg tggcggctca ccagttcctc ggcgtgtccc agcacgacgt ggcggttccg       300
     atgtcgcaac tggactatgc gaacggcaag ctcgtctggg ccggcgccac gcgtgaggtg       360
     gtcaagtcgc tgcccgtgtt catctattcg aaggttcgca cggttcctat tgcccgcaag       420
     gactacggcc atcattga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page