(data stored in SCRATCH zone)

EMBL: CP000271.PE65

CP000271.PE65        Location/Qualifiers
FT   CDS_pept        74463..75512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2962"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2962"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33033"
FT                   /db_xref="GOA:Q13SA6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA6"
FT                   /protein_id="ABE33033.1"
FT                   /translation="MKNSVPSPAFGTAQAQAQPLAQATRGKRARSELARLRELALLPAL
FT                   ALLIVIGAFVSPSFLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLESTVGIAPA
FT                   VGAMLVMPAASAGFGMQWPAAAGLLAIVAVGAVIGFINGFLVVRLRLNAFIVTLAMLIV
FT                   LRGMLVGATKGGTLFDMPPSFFTLATTIVFGLPLSVWLAAVAFAIAAFVLRYHRLGRAL
FT                   YAIGGNPEAARAAGIRVERITWGVFVLGSMLASLGGLIVTGYVGAINANQGNGMIFTVF
FT                   AAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIILGSLMVA
FT                   RLASGEGQN"
     atgaagaata gtgtgcccag tcccgccttc ggcaccgcgc aagctcaggc ccagccgctc        60
     gcgcaggcta cgcgcggcaa acgcgcgcgc tccgaactcg cgcgtctgcg cgagctggcg       120
     ttgctgcccg cgctcgcgtt gctgatcgtg atcggcgcgt tcgtcagccc cagctttctg       180
     accaaagcga atctcatcag cgtgctgggt gcttcggcgg cgctggcgct ggtcgtgctc       240
     gccgaatcgc tgatcgtgct gaccggcaag ttcgatttgt cgcttgaatc gacggtcggc       300
     attgcgcccg ccgtgggcgc aatgctggtg atgcccgcgg cgtccgcggg cttcggcatg       360
     caatggccgg cggcggccgg cttgctcgcc atcgtggcgg tgggcgcggt gatcggtttc       420
     atcaacggct ttctcgtggt gcgtttgcgg ctgaacgcgt tcatcgtcac gctggccatg       480
     ctgatcgtgc tgcgcggcat gctggtcggc gcgaccaagg gcggcacgct gttcgatatg       540
     ccgccgtcgt tttttacgct cgcgaccacc atcgtgttcg gcttgccatt gtccgtgtgg       600
     cttgccgccg tggcgttcgc gatcgcagcc ttcgtgttgc gctatcaccg gctgggccgc       660
     gcgttgtacg cgatcggcgg caatccggaa gcggcgcgcg cggcgggcat tcgtgtggag       720
     cgcatcacgt ggggcgtgtt cgtgctcggc agcatgctcg cctcgctggg cggtttgatc       780
     gtcaccggct atgtcggcgc gatcaacgcg aaccagggca acggcatgat cttcacggtg       840
     ttcgcggccg cggtgatcgg cggtatttcg ctcgacggcg gcaagggcac catgttcggt       900
     gcgctcaccg gcgtgctgct gctcggcgtg gtgcagaacc tgctgacgct tgcccaggtg       960
     ccgtctttct ggatccaggc gatctacggc gcgatcattc tcggctcgct gatggtggcg      1020
     cgcctcgcaa gcggcgaagg ccagaactga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page