(data stored in ACNUC7421 zone)

EMBL: CP000271.PE651

CP000271.PE651       Location/Qualifiers
FT   CDS_pept        760705..762027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2370"
FT                   /product="Putative phthalate 4,5-dioxygenase oxygenase
FT                   subunit (OhpA2)"
FT                   /note="Citation: J. Bacteriol. 180 (24), 6529-6537 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33619"
FT                   /db_xref="GOA:Q13QM0"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM0"
FT                   /protein_id="ABE33619.1"
FT                   /translation="MLSHEDNETLVRVGPGTPTGQFMRLYWLPFLPSSDLTVDGQPQRV
FT                   RLLGEDLIAFRDSEGRVGLVDHVCPHRGAPLVFGRNENCGLRCVYHGWQFGVDGQVIDT
FT                   PAEPAESRLKDKVRIRSYPCRERNGIVWAYMGEADANALPPLPNLEWNMVPLENVHFSF
FT                   RVQECNWLQAVEGEIDSAHAPILHGRIDSQGAINEWTAKRDLRPVFECQRREFGISIAS
FT                   RRVLDDSHHYWRVNQFLFPFYTLVPPQSKYPELSGHAWVPVDDENTLCLMFSYTPAAPL
FT                   YEKTRKLFEDGHAGRETGHASAHAFAPRPVTQPYAKYWTRFNLESAFQFDYDAQTKTWF
FT                   SGLPGLWVQDAACQSGVAPIYDRRKENLGISDTGVAMTRRLLLENVRKLASERVSPVRV
FT                   DDPDLWMVRAVSLTLPAGAPWQSDGAEHMRARLGADFGYTP"
     atgctttccc acgaagacaa cgagaccctg gtgcgggtcg gccccggcac gccgaccgga        60
     caattcatgc gcctttactg gctgccgttc ctgccgtcgt cggatctgac cgtcgacggc       120
     cagccgcagc gcgtgcgtct gctaggcgaa gatctgatcg cgtttcgcga cagcgaaggg       180
     cgggtcggtc ttgtcgatca tgtctgcccg catcgcggcg cgccgctggt gtttggccgc       240
     aacgagaact gcggattgcg ctgcgtctat cacggctggc agttcggcgt ggatgggcag       300
     gtgatcgata cgcccgccga gcccgcagag agccggctca aggacaaggt acgcatcagg       360
     agctatccgt gccgcgaacg caacggcatc gtttgggcat acatgggtga ggccgatgca       420
     aacgcgctgc cgccactgcc gaatctcgaa tggaatatgg tgccgctgga gaacgtgcac       480
     ttcagcttcc gcgtgcagga atgcaactgg ctgcaggcgg tggaaggcga gatcgattcg       540
     gcgcacgcgc cgatcctgca tggccgcatc gactcgcaag gcgcgatcaa cgaatggacc       600
     gccaagcgcg atctgcgtcc tgtgttcgag tgccagcggc gcgagttcgg tatcagcatc       660
     gcgtcgcgcc gggtactcga cgacagtcac cactactggc gcgtcaacca gttcctgttt       720
     ccgttctaca cgctcgtgcc gccgcaatcg aagtatccgg aactgagcgg ccacgcatgg       780
     gtgccggtcg acgacgaaaa cacactctgc ctgatgttct cgtacacgcc ggccgcgccg       840
     ctctacgaga aaacccgcaa gctgttcgaa gacggccacg cgggacgcga gaccggccac       900
     gcgagtgcgc acgcgttcgc gccgcgaccg gtcacgcagc cgtatgcgaa gtactggacc       960
     cgcttcaacc tcgaatcggc tttccagttc gattacgacg cgcagacgaa aacctggttc      1020
     tccggcctgc cgggcttgtg ggtgcaggac gccgcatgcc agtcgggcgt tgcgccgatc      1080
     tacgaccgcc gcaaggaaaa tctcggcatc agcgatacgg gcgtggcgat gacccggcgc      1140
     ctgctgctcg aaaacgtgcg caagttggcg tccgaacgtg tgtcgccggt gcgggtggac      1200
     gatccggatc tctggatggt gcgtgccgtg tcgttgacgt tgcccgcggg cgcgccctgg      1260
     caaagcgacg gcgctgaaca catgcgcgcg cgcctcggcg ccgatttcgg ctacacgccc      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page