(data stored in ACNUC7421 zone)

EMBL: CP000271.PE652

CP000271.PE652       Location/Qualifiers
FT   CDS_pept        762054..763016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2369"
FT                   /product="Putative phthalate 4,5-dioxygenase reductase
FT                   subunit (OhpA1)"
FT                   /note="Citation: J. Bacteriol. 180 (24), 6529-6537 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33620"
FT                   /db_xref="GOA:Q13QL9"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL9"
FT                   /protein_id="ABE33620.1"
FT                   /translation="MSQHNADRIDVRLTQIRLEADDVASYEFRPIGTPVLPAFEAGAHI
FT                   DLYLPENRVRSYSLVNAPHERHRYVIAVQREAAGRGGSAWMHRTPRVGDRFTIGAPMND
FT                   FPLCEAARQSVFICGGIGITPIVSMIRRLERTGASWQLHYAARERSRAAYADDLAQIDE
FT                   AGSRITMHLESEGGRLDLRRVVERAPADAHLYCCGPRGMVDAFIEACASRPRAQVHFER
FT                   FAAANESATAGGFDVVLGRDGRRIPVAPGKTILDTLLDHGVDVQYACSAGVCGTCRTGV
FT                   IDGVPDHRDDYLTDEEKAGNRAVMVCCSGSLSPTLVLDL"
     atgtctcagc acaacgccga tcgtatcgac gtccgtctca cgcagatccg tctggaagcg        60
     gacgacgtgg cgtcctacga attccggccc atcggtacgc ccgttttgcc ggccttcgaa       120
     gccggcgcgc acatcgacct ttatctgccc gagaaccgtg tgcgcagcta ttcgctggtc       180
     aacgctcctc atgaacgcca ccgttatgtg attgccgtgc agcgcgaggc ggccggtcgc       240
     ggcggctccg catggatgca ccgcacgccg cgggtcggcg accgcttcac gatcggcgcg       300
     ccgatgaacg actttccgct gtgcgaagca gcacggcaat cggtgttcat ctgcggcggc       360
     atcggcatca cgccgatcgt ttcgatgatc aggcgtctcg agcgcaccgg cgcatcgtgg       420
     caattgcact atgccgcgcg cgagcgctca cgtgcggcgt atgcagacga tctcgcgcag       480
     atcgacgaag ccggctcgcg catcaccatg catctggaaa gtgaaggtgg gcggctcgac       540
     ttgcggcgtg tggtggaacg cgcgcccgcg gacgctcacc tgtattgctg cggaccgcgc       600
     ggcatggtcg acgcgtttat cgaagcatgc gcgtcgcggc ctcgcgcgca ggtgcacttc       660
     gagcgtttcg cggccgcgaa cgaatcggca acggccggcg gcttcgacgt ggtgctcggg       720
     cgcgacggca gacgtattcc ggtcgcgccc gggaagacga tcctcgacac gctgctggat       780
     cacggcgtcg acgtccagta cgcctgctcg gccggcgtgt gcggcacttg ccgcaccggc       840
     gtgatcgacg gcgtgcccga tcatcgcgac gattatctga ccgacgagga gaaggcgggg       900
     aaccgtgcgg tgatggtgtg ctgttcgggt tcgttgtcgc cgacgttggt gctcgatctc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page