(data stored in ACNUC7421 zone)

EMBL: CP000271.PE653

CP000271.PE653       Location/Qualifiers
FT   CDS_pept        763078..764385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2368"
FT                   /product="Putative L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33621"
FT                   /db_xref="GOA:Q13QL8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL8"
FT                   /protein_id="ABE33621.1"
FT                   /translation="MLSRLVNEFPEHEPRPANAPKALAGIRVVDFTHFIAGPFATMMLA
FT                   DMGAEVIKIEAPGRGDEFRYYPPAHPEDASIGGPYLWANRNKRSIALDLKSAEGRRIAR
FT                   ELVATADIVAENFSTGVMERLGLSYEACRELNPQVIYCSVSAYGREGAFADRLGFDPIA
FT                   QAESGFVSMNGYPDRLGVRALSPVMDISTAMMASNAMLGALVARERTGKGQAVEVSLFD
FT                   NAVLMTGYATVQHLFTGEEPRRHGNTSPDTCPSGVFKAADKAFYINCGNDKIFHRLANQ
FT                   VLEMPELAADPVLADRNGRIARRDELFRILDEAFIRHPWAHWQQRMRAASIPCGEVRTV
FT                   GEALRSPEARERKLVSRLEHPELGWLPNINLPFRFSETPIDDPSPAPRVGEHSRSILTE
FT                   VLGYSGEGADALLRSGSVYSCDQVVAAAGGAEVSAS"
     atgctttcca gactggtcaa tgaatttccc gagcacgagc cgcgtcccgc caatgcgccc        60
     aaggcgctcg ccggcattcg cgtggtcgac ttcactcact ttatcgccgg gccgttcgcg       120
     acgatgatgc tggccgacat gggcgcggag gtcatcaaga tcgaagcgcc ggggcgcggc       180
     gacgagttcc gttattaccc gccggctcat cccgaggacg ccagcatcgg cggcccctat       240
     ctctgggcga atcgcaacaa gcgcagcatt gcgctcgatc tgaaatcggc ggagggacga       300
     cgcatcgcgc gcgaactggt cgcgacggcg gacatcgtgg cggagaattt ttcgaccggc       360
     gtgatggagc gtctcggtct gagctacgaa gcctgccgcg agctgaatcc gcaggtgatc       420
     tactgctcgg tctccgctta tggacgcgaa ggtgcgttcg cggaccggct gggattcgac       480
     ccgatcgcgc aggccgagag cggattcgtg tcgatgaacg gctatccgga tcgccttggc       540
     gtgcgtgcgc tgtcgccggt aatggacatc agtacggcaa tgatggcgag caatgccatg       600
     ctcggcgcgc tggtcgcacg cgaacgcacc ggcaagggcc aggctgtcga ggtttcgctg       660
     ttcgacaacg ccgtgctgat gaccggctac gcgacggtgc agcatctgtt caccggcgag       720
     gagccgcgcc gccacggcaa tacgagtccg gatacgtgtc cgtcgggcgt tttcaaggcg       780
     gcggacaaag cgttctacat caattgcggt aacgacaaga tattccatcg gcttgccaac       840
     caggtgctgg agatgcccga actggccgcc gacccggtgc ttgccgatcg caacggccgc       900
     atcgcgcggc gcgacgaact gtttcgtatc ctcgacgaag cgttcattcg ccacccttgg       960
     gcgcattggc agcaacgcat gcgagccgcg tcgatcccgt gcggcgaagt acgtacggtc      1020
     ggcgaggcgc tgcgttcgcc ggaagcacgc gagcgcaagc tcgtaagccg tcttgaacat      1080
     ccggagctcg gctggctgcc gaatatcaat ctgccgttcc gcttcagcga gacgccgatc      1140
     gacgatcctt cgcccgcgcc gcgcgtgggc gaacacagtc gctcgattct gactgaggtg      1200
     ctgggttact ccggcgaagg cgcggatgcg ctgctgcgaa gcggctcggt gtatagctgc      1260
     gatcaggtgg ttgccgccgc gggcggagcc gaggtctccg cgtcatga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page