(data stored in ACNUC7421 zone)

EMBL: CP000271.PE654

CP000271.PE654       Location/Qualifiers
FT   CDS_pept        764382..765563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2367"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33622"
FT                   /db_xref="GOA:Q13QL7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL7"
FT                   /protein_id="ABE33622.1"
FT                   /translation="MTERTLRGQVAVVGVGESEYYRAGHAPDPEFRLLLKAVLAACRDA
FT                   DIDPADIDGFASFADDRNDAVRIATALGVKRLRSTTMQWGGGGGGCAAAVANGAAAIMS
FT                   GMAQCVLVYRGLAQGQFGRFGQAAPRASISGEMAYQMPYGVLAPPQKFAMKVQRFMHEH
FT                   GVRREALRAIALASYQHAQANPRAVMHGKPLTAEAYDASRWIVEPFRLFDCCMENDGAG
FT                   ALLLVAAERAKDFPHRPVYLLGAASGGDWRAAASPHNAPHYASANYSGVSGDLYRMARV
FT                   SPADVGVVQSYENFTGGVAMALSEHGFFHPDEANDFLTPENLVAPSGKLPLNTSGGNLG
FT                   ECYVHGFELVIEAARQVRGESTSQAARHDVALVIGGPMVTPASSLLFGSAATL"
     atgacggagc gcacgctacg cgggcaggtc gcggtagtgg gcgtcggcga gagcgaatac        60
     taccgtgccg gccacgcgcc ggacccggaa ttcagacttc tgctcaaggc ggtgctggcg       120
     gcgtgccgcg atgcggatat cgacccggcg gacatcgacg gcttcgcctc gttcgccgac       180
     gatcgcaacg acgcggtgcg tatcgccacg gcgctcggcg tgaagcgctt gcgctccacg       240
     acgatgcagt ggggcggcgg aggcggcggc tgtgccgccg cggtggccaa cggcgcggcc       300
     gcgatcatga gcggcatggc gcagtgcgtg ctggtctatc gcgggcttgc gcagggacag       360
     ttcgggcgct tcggccaggc ggcgccgcgt gcgtccattt ctggcgagat ggcatatcag       420
     atgccgtatg gcgtgcttgc gccgccacag aagttcgcga tgaaggtgca gcgtttcatg       480
     cacgaacacg gcgtgcgccg cgaagcgctg cgcgcgatcg cgctcgcgtc ctatcagcac       540
     gcgcaggcca atccgcgcgc ggtgatgcac ggcaaaccgc tgaccgccga agcgtacgac       600
     gcatcgcgct ggatcgtcga gccgtttcgt ctgttcgatt gctgcatgga gaatgacggc       660
     gcgggcgcgt tgctgctggt ggccgcagaa cgcgcgaaag actttccaca tcggccggtg       720
     tatctgcttg gcgcggcgag cggcggtgac tggcgagcgg ccgcctcgcc gcacaacgcg       780
     ccccattacg cgagtgccaa ctatagcggc gtttcaggcg atttgtaccg gatggcgcgc       840
     gtgtcgcccg cggacgtcgg cgtggtgcag agctatgaga acttcaccgg aggcgtggca       900
     atggcgctga gcgagcacgg gtttttccat cccgacgaag ccaacgattt tctaacgccg       960
     gagaatctcg tcgcgccgtc gggcaagctg ccgctcaaca cgagcggcgg caatcttggc      1020
     gaatgctacg tgcacggctt cgaactggtg atagaagcgg cgcgccaggt gcgcggcgag      1080
     tcgaccagtc aagcggcgcg gcatgacgtg gcgctggtga tcggcggccc gatggtgacg      1140
     ccggcaagca gcctgctgtt cggatcggcg gcaacgttat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page