(data stored in ACNUC7421 zone)

EMBL: CP000271.PE655

CP000271.PE655       Location/Qualifiers
FT   CDS_pept        765560..766018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33623"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL6"
FT                   /protein_id="ABE33623.1"
FT                   /translation="MTDSSASPTYLPAGLPAPVPEPDGLSAPYWAGLREEKLRVQRCAH
FT                   CRTWQFGPEWICHGCRTFDPAWHEVAPRGRIFSWERVWHPSHPALAQATPYLVVLVELP
FT                   HAGHVRMLGNLLGDPRQQVEMGAAVTGVFEHHAEAATPYSLLQWRLST"
     atgacggatt catccgcgtc gccgacgtat ctgcccgccg gacttcccgc cccggtgccc        60
     gaaccggacg gcttgtccgc gccatattgg gcgggtctgc gggaagaaaa gttgcgcgtg       120
     cagcgttgtg cgcactgtcg cacctggcaa ttcgggccgg agtggatctg tcacggatgc       180
     cgtaccttcg accccgcgtg gcatgaagtg gcgccgcgcg gccgcatctt cagctgggag       240
     cgcgtctggc acccgtcgca cccggcgctc gctcaagcga cgccgtatct ggtggtgctg       300
     gtggaattgc cgcacgcggg ccatgtgcgc atgctcggca acctgctcgg cgatccccgt       360
     cagcaggtcg aaatgggcgc ggcggtgact ggcgtgttcg agcatcatgc cgaagccgcg       420
     acgccttaca gtctgctgca atggcggctt tcgacgtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page