(data stored in ACNUC7421 zone)

EMBL: CP000271.PE659

CP000271.PE659       Location/Qualifiers
FT   CDS_pept        complement(770320..770634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL2"
FT                   /protein_id="ABE33627.1"
FT                   /translation="MSIYILNEVCKKRVLVRCSRLTSKRSTVDFRTTKKRSTTNISGHP
FT                   KRGMLTFSPRVACPSSSFFSARCRKGRLAAGNLPAWEDRRAEWVAGDLLCEYCLGARGA
FT                   "
     ttgtcgattt atatcctgaa cgaggtgtgc aagaaacgcg tcctggtgag gtgctcacga        60
     ttaaccagta agcgctcgac ggttgacttt agaacgacaa aaaagagaag cacaacaaat       120
     atttctggac atcccaagcg tgggatgctt acgttctcgc cgcgcgttgc gtgcccgagc       180
     tcgtcatttt tttcagcgcg gtgtcgtaag gggaggcttg ctgccggaaa tttgccggca       240
     tgggaagacc gccgcgcgga gtgggtggcg ggcgatctat tatgtgaata ttgcctggga       300
     gcgcgggggg cgtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page