(data stored in SCRATCH zone)

EMBL: CP000271.PE68

CP000271.PE68        Location/Qualifiers
FT   CDS_pept        77360..78400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2959"
FT                   /product="Putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2959"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33036"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA3"
FT                   /protein_id="ABE33036.1"
FT                   /translation="MTATIASKIGQRRRIGRTALQVTGLGLGTAPLGGLYRDLSDEEAH
FT                   ATIAAAWDAGVRYFDTAPHYGNTKAEHRLGDVLRRYPRGDYVLSTKVGRRFVPRTTPFD
FT                   DREGWQNPLPFEAIYDYTHDGILRSFEDSQQRLGIVDIDILLVHDIGRVTHGDNHPHYW
FT                   RQLTEGGGFRALDGLRSAGAIKAVGLGVNEGAVILDAMAEFDIDCALLAGRYTLLEQST
FT                   LDDLLPACETRGVSILLGGAFNSGILARGVEGDLKFNYGEAPREVIERVARLDAVCHAH
FT                   AVPLAAAALQFPYAHPAVATVLTGARSADELRENAASFGQPIPAGLWSALRDEGLLDSR
FT                   APVPED"
     atgacggcaa cgatcgcatc gaagatcggg caacggcgcc gcatcggccg cacggcgttg        60
     caggtgacag gactgggact cggtacggcg ccgctcggcg gcctctaccg cgatctgtcc       120
     gacgaggaag cgcacgccac catcgccgcc gcgtgggacg cgggcgtgcg ctacttcgac       180
     accgcgccgc actacggcaa cacgaaggcc gagcatcggc tgggcgacgt cttgcggcgt       240
     tatccgcgcg gcgactatgt gctgtccacc aaagtgggcc gccggttcgt gccgcgcacc       300
     acgcctttcg acgaccggga aggctggcaa aacccgctgc ctttcgaagc gatctacgac       360
     tacacgcacg acggcattct gcgctcgttc gaagacagcc agcagcggct cggcattgtc       420
     gatatcgaca ttctgctggt gcacgatatc ggccgcgtta cgcacggcga caaccatccg       480
     cactactggc ggcaactcac cgaaggcggc ggttttcgcg cgctggacgg gttgcgctcg       540
     gcgggcgcga tcaaggccgt cggactcggg gtcaacgagg gcgcggtcat tctggatgcg       600
     atggccgagt tcgatatcga ttgcgcgttg ctcgcgggac gttatacgct gctcgaacag       660
     agcacgctcg acgacctgtt gccggcctgt gaaacgcgcg gcgtcagcat tctgttaggc       720
     ggcgcgttca actcgggcat tctggcgcgc ggcgtcgaag gtgatctgaa attcaattac       780
     ggcgaggcgc cgcgcgaagt gatcgagcgc gtcgcgcggc tcgacgcggt gtgccatgcg       840
     catgccgtgc cgctggcggc cgccgccttg cagtttccgt acgcgcatcc ggcggtcgcc       900
     accgtgctga ccggcgcgcg cagtgccgac gaattgcgcg agaacgccgc gtcgttcggg       960
     cagccgatcc ccgcgggctt gtggtccgcg ttgcgtgacg aaggcttgct cgacagccgc      1020
     gcgcccgtgc cggaggattg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page