(data stored in ACNUC7421 zone)

EMBL: CP000271.PE69

CP000271.PE69        Location/Qualifiers
FT   CDS_pept        78408..79238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2958"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33037"
FT                   /db_xref="GOA:Q13SA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA2"
FT                   /protein_id="ABE33037.1"
FT                   /translation="MHIDAHQHYWDPARGDYEWLTPELKILYRTFGPADLKPLRERAGI
FT                   ERTVVVQAAPTIDETRYLLDIARHEPSIAGVVGWVPLLLPTAPAVIEALAHEPKFKGVR
FT                   PMLQDLPDDTWIANPDLAPAIEALIAHDLAFDALIYARHAEPFETFATRFPALRIVVDH
FT                   GAKPPIRYGRAGYQSWADAITRLAQLPHVHCKLSGLATEASPGWTEATLQPYVDHLLKS
FT                   FGPARLMWGSDWPVLDLNGDYLLWHSVANTLLSSLSDGEREAVFGGNAAAFYRL"
     atgcatatcg atgcccacca gcactactgg gaccccgctc gcggcgacta cgagtggctc        60
     acgccggaac tgaagatcct gtaccggacg tttggcccgg cggatctcaa accgttgcgc       120
     gagcgcgcgg gcatcgaacg gacggtggtg gtgcaggccg cgccgaccat cgacgaaacg       180
     cgttatctgc tggacattgc gcggcatgag ccgtcgatcg cgggcgtggt cggctgggtg       240
     ccattgctgt tgcccacggc gccggcggta atcgaagcac tggcacatga gccgaagttc       300
     aagggcgtgc ggccgatgct gcaggatttg ccggacgata catggatcgc caaccccgat       360
     ctcgcgccgg cgatcgaagc gctgatcgcg cacgacctcg cgttcgacgc gttgatttac       420
     gcgcgccacg ccgagccctt cgaaaccttc gcaacgcgct ttccggcgct gcgcatcgtg       480
     gtcgatcatg gcgcgaagcc gcctatccgc tacggacgcg cgggctatca aagctgggcc       540
     gacgcgatca cacgcctcgc gcaactgccg cacgtgcatt gcaagctgtc gggcctcgcc       600
     accgaggctt cgcccggctg gaccgaggcg acgctgcaac cgtatgtcga ccatctgctg       660
     aagtcattcg gcccggcgcg tttgatgtgg ggcagcgact ggccggtgct cgatctgaac       720
     ggagactatc tgctctggca ttcggtagcg aacaccttgc tcagctcctt gagcgacggc       780
     gagcgcgaag cggtgttcgg cggcaacgcc gccgcgtttt atcgactgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page