(data stored in ACNUC7421 zone)

EMBL: CP000271.PE71

CP000271.PE71        Location/Qualifiers
FT   CDS_pept        80084..80932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2956"
FT                   /product="Fumarylacetoacetate hydrolase family protein"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2956"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33039"
FT                   /db_xref="GOA:Q13SA0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA0"
FT                   /protein_id="ABE33039.1"
FT                   /translation="MKLLRYGPKGQEKPGLLDAQGKIRDLSKVVADIDGAALTDEGLAR
FT                   LRALDPASLPLVEGNPRIGPCVGKIGKFICIGLNYADHAAESNLPVPAEPVIFNKWTSA
FT                   ISGPNDDVEIPRGSKKTDWEVELGVVIGKPAKYIDEANALDYVAGYCVINDVSEREWQI
FT                   EKGGTWDKGKGFDTFGPIGPWVVTRDEVADPQNLSLWLEVDGHRYQNGSTKTMVFGVAK
FT                   LVSYVSQCMSLQPGDVISTGTPPGVGMGVKPNPVFLKPGQTIRLGIEGLGEQTQKTYAA
FT                   E"
     atgaaactgc ttcgttatgg gccgaaaggc caggaaaagc cgggcttgct cgacgcgcaa        60
     ggcaagattc gtgatctgtc gaaagtggtg gccgatatcg acggcgccgc gctgaccgac       120
     gaaggtctcg ccagattgcg cgcgctcgat ccggcctcgc tgccgctggt cgaaggcaat       180
     ccgcgcatcg gcccgtgtgt cggcaagatc ggcaagttca tctgcatcgg cttgaattac       240
     gcggatcacg cggcggaatc gaatctgccg gtgccggccg aaccggtcat cttcaacaag       300
     tggacgagcg cgatcagcgg accgaacgac gacgtggaaa ttccgcgcgg ctcgaagaaa       360
     acggattggg aagtcgaact cggcgtggtg atcggcaagc cggcgaaata tatcgacgaa       420
     gccaacgcgc tcgattacgt cgccggttac tgcgtgatca acgacgtgtc ggaacgcgaa       480
     tggcagatcg aaaagggcgg gacgtgggac aagggcaagg gttttgatac gttcggcccg       540
     atcggtccgt gggtggtcac gcgcgatgaa gtcgcggacc cgcagaatct gagcctgtgg       600
     ctcgaagtgg acggccatcg ctatcagaac ggcagcacga agacgatggt gttcggcgtc       660
     gcgaaactgg tctcgtacgt gtcgcagtgc atgagcctgc aaccgggcga cgtgatttcc       720
     accggcacgc cgccgggcgt cggcatgggc gtgaagccga atccggtgtt cctgaagccg       780
     ggccagacga ttcgcctggg tattgaaggt ctgggcgagc aaacgcagaa gacttacgcg       840
     gcggagtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page