(data stored in ACNUC7421 zone)

EMBL: CP000271.PE74

CP000271.PE74        Location/Qualifiers
FT   CDS_pept        complement(82931..83365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2953"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2953"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33042"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S97"
FT                   /protein_id="ABE33042.1"
FT                   /translation="MTDLLDRARGALHAQPFSMLLGAELMHTGTNELTLSLPIRDELRQ
FT                   QHGFVHGGVISYLVDNALTFAGALLLGPKVVTGEYKINYLRPAVNGMLIARAKVVYAGQ
FT                   HQATCQCNVFVMEGNREKLIAVAQGTVNRISESGEHEHGN"
     atgaccgacc tcctcgaccg ggcgcgcggc gcactgcatg cccagccgtt cagcatgctg        60
     ttgggcgcag agttgatgca cacaggcacc aacgaactca cgctgagcct gccgatccgc       120
     gacgagctgc ggcaacagca cggcttcgtg catggcggcg tgatcagcta tctcgtcgac       180
     aatgcgctga cattcgccgg cgcgctgctg ctggggccga aggtcgtgac cggggaatac       240
     aagatcaatt acctgcgccc ggccgtcaac ggcatgctga tcgcgcgcgc gaaggtggtc       300
     tatgcgggcc agcatcaggc aacctgccaa tgcaacgtgt ttgtcatgga aggcaatcgc       360
     gaaaagctga ttgccgtcgc gcaaggcacg gtgaaccgga tcagcgagag cggcgaacac       420
     gaacacggga actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page