(data stored in ACNUC7421 zone)

EMBL: CP000271.PE77

CP000271.PE77        Location/Qualifiers
FT   CDS_pept        85793..86068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S94"
FT                   /protein_id="ABE33045.1"
FT                   /translation="MTHYLQEELTSFWSRLTPYLAILESKSPQEGAPDPVGRITVDTVD
FT                   RQAFALHTTDQKPHGDASDIPTGQSATYMRFKSAGSDWSPWQREEY"
     ttgacacatt atttgcaaga agaacttacc tcgttctgga gtcgtttgac cccctatctg        60
     gcgatattgg agtctaaatc ccctcaagaa ggcgccccgg acccggtcgg ccgtatcact       120
     gtcgatacgg tagaccgcca ggctttcgcc cttcacacga ccgatcagaa gccgcacggc       180
     gacgcatcgg atatccccac cgggcagagc gcaacttata tgcgttttaa atctgccggc       240
     tccgattgga gcccctggca gcgcgaagag tactga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page