(data stored in SCRATCH zone)

EMBL: CP000271.PE80

CP000271.PE80        Location/Qualifiers
FT   CDS_pept        88338..89693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2947"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2947"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33048"
FT                   /db_xref="GOA:Q13S91"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S91"
FT                   /protein_id="ABE33048.1"
FT                   /translation="MADSVASTQSRPSRAASKKRRQATVSTETENKLARAARSAQRLAQ
FT                   LSDASRDDATLDLFPDDPTRATLEAMNIDIRQGTLHGFELPDVVLAAVGAIDTGDSASL
FT                   EARAARRAPRTPKSDEPVPVNAQLSGLEIESVAAMAAMVSPVGELALGDTKPATDANAE
FT                   EKPAVSAPLTPAMAAATVARSVTALRQASEPGAATGVTTDTPVASTSGVGKAPQRFAAT
FT                   FAKAASASASASALRGTHTAETTSAVDEPAPAESDAAPTESKAGTETLAHPSAPAQAST
FT                   EFATPWREARRAEAAAAALRAAPELDRARATAFADTVDALYGVIADQRRAATDHSRRMK
FT                   WMLSIVVGALLVTVAIGITQTVLLIRLTRETTAQQHRIEQMMQNQQAAMTSLLDTHLAM
FT                   AMAMANAVAVNAAPAAATAAPATPQQATATAAHTRRTVRAQHSHRPKAASPH"
     atggcagatt ccgtagcatc cacgcagtcc cggccttcgc gcgcagcttc gaagaagcgg        60
     cgtcaggcca ccgtctcgac cgaaactgaa aacaagctgg cgcgcgccgc gcgctcggca       120
     caacgtctcg cgcaattgag cgacgcctct cgcgacgacg ccacgctcga tctgttcccc       180
     gacgatccca cccgcgcgac gctggaagcg atgaacatcg atatccggca aggtacgctg       240
     catggtttcg aattacccga tgtagtgctg gccgcggtcg gcgcgatcga tacgggcgac       300
     agcgcgtcgc tcgaggcgcg ggcggctcgc cgcgcaccgc gtaccccgaa gtccgatgaa       360
     ccggtgccgg tcaatgcgca attgagcggg ctcgaaatcg agtcggtggc ggcgatggcg       420
     gcaatggtgt cgccggttgg cgaactggct ttgggtgaca cgaaaccggc aacggatgct       480
     aacgccgaag agaaaccggc ggtgtcggcg ccgctgacgc cggctatggc ggctgcaacc       540
     gtggcgcgca gcgtgaccgc gctgcggcag gcgtccgagc cgggcgcggc gacgggcgtg       600
     accactgata cccccgttgc gtcgacctcg ggcgtcggca aggcgccgca acgtttcgcc       660
     gcgactttcg ccaaggcggc atcggcatcg gcatcggcat cggctttgcg gggaacgcat       720
     acggctgaaa ccacgagcgc ggtagatgaa cccgctccgg ccgaatcaga cgccgcaccc       780
     acggagtcga aggccggcac ggagacattg gcgcatccat cggcgcctgc tcaggcgagc       840
     accgagttcg cgactccctg gcgcgaagcc cggcgtgccg aggcggctgc ggccgcgttg       900
     cgcgccgcgc cggaactcga tcgcgcgcgg gcaaccgcct tcgccgatac cgtcgatgcg       960
     ctatatggcg tgattgccga tcagcgccgc gccgcgaccg atcattcgcg acgcatgaag      1020
     tggatgcttt cgatcgtggt gggtgcgttg ttggtcacgg tcgccatcgg catcacgcaa      1080
     accgtgctgc taatacgcct gacgcgtgag accaccgcgc agcagcaccg tatcgaacag      1140
     atgatgcaaa accagcaggc cgccatgacc agcttgctcg acacccatct ggcgatggcg      1200
     atggcgatgg cgaatgctgt cgctgtgaat gctgctcccg ctgcggccac ggcggcgcct      1260
     gccacccctc agcaagccac cgccacggcg gcgcatacaa ggcgcaccgt acgggcgcag      1320
     cattcgcaca ggccgaaagc ggccagcccg cattga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page