(data stored in ACNUC7421 zone)

EMBL: CP000271.PE82

CP000271.PE82        Location/Qualifiers
FT   CDS_pept        90619..90918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2945"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2945"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33050"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S89"
FT                   /protein_id="ABE33050.1"
FT                   /translation="MKTFNKTSRSLIATLLAGGALLAAGSAFAQERVVVENGPGPAVYG
FT                   QPHMMPVGVSINIGWHGDRYYDGHRYWAHDDWMRHHPHDYDPHHHGDRRPPPHY"
     atgaaaacct ttaacaagac atcgcgttcg ctcattgcaa ccctgctcgc gggaggcgcg        60
     ctgctcgcgg cgggcagcgc attcgcccag gaacgggtgg tggtggagaa cggtccggga       120
     ccggcggtct acggtcagcc gcatatgatg ccggttggcg tgtcgatcaa catcggctgg       180
     catggcgatc gttactacga cggccatcgc tactgggctc atgacgactg gatgcgccat       240
     cacccgcatg actacgatcc gcatcaccac ggcgaccgtc gtccgccgcc gcactactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page