(data stored in SCRATCH zone)

EMBL: CP000271.PE84

CP000271.PE84        Location/Qualifiers
FT   CDS_pept        92146..92796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2943"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2943"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33052"
FT                   /db_xref="GOA:Q13S87"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S87"
FT                   /protein_id="ABE33052.1"
FT                   /translation="MPFQPNPQSQLISMSHYFYDPATGHGLAHDPFKAIVAPRLIGWIS
FT                   SRDTEGTLNLAPYSFFGAFATFPPIIGFCSEGRKDSVTNIEATGEFVWNLANKPLAEQM
FT                   NRSSAPVPPSVDEFELAGLTPAPGRNVAVPHVAESPAALECKLLQVVRLHTLDGTPMDN
FT                   YLSLGQVVGVHINEAYLKDGLFDTHAAQPIMRAGYRADYAEIGDMFQMFRPGA"
     atgcccttcc agccaaatcc gcaaagccaa ctcatttcca tgtcccacta cttctacgat        60
     cccgccaccg gccacggcct tgcgcacgat ccgttcaaag ccatcgtcgc tccgcgtctg       120
     atcggctgga tttcgtcgcg cgataccgaa ggcaccttga atctcgcgcc gtacagtttc       180
     tttggcgcgt tcgccacctt cccgccgatc atcggttttt gcagcgaagg tcgtaaggac       240
     agtgtcacca acatcgaagc caccggcgaa tttgtctgga acctggccaa caaaccgctc       300
     gccgagcaga tgaaccgttc gtcggcgccg gtcccgccgt ctgtcgatga attcgaactc       360
     gccggcctca cgcctgcgcc gggccgcaac gttgccgtgc cgcacgtcgc cgaatcgccg       420
     gccgcgctcg aatgcaaact gctgcaagtg gtgcgtctgc atacgctcga cggcacgccg       480
     atggataact acctgtcgct cggccaggtg gtcggcgtcc acatcaacga ggcctatctg       540
     aaagacggcc tgttcgacac ccacgccgcg cagccgatca tgcgcgccgg ctaccgcgcg       600
     gactacgcgg aaatcggcga catgttccag atgttccgcc cgggcgcata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page