(data stored in SCRATCH zone)

EMBL: CP000271.PE85

CP000271.PE85        Location/Qualifiers
FT   CDS_pept        92978..93412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2942"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2942"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33053"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S86"
FT                   /protein_id="ABE33053.1"
FT                   /translation="MSTEFATQFSHVRPQDTSYEDQGLRDFFLYRDLGIAQATGGKVLA
FT                   QLVKANHAPEQGTGWHRHEADFHIVIMLKGWARFMYGDKETLVAAGDCVHQAPGIVHYL
FT                   FDYSDDMEYIEIVSPADFKSIEVEGPCDVPAVTPWKGVAA"
     atgtccaccg aattcgccac gcaattcagc catgtccgtc cgcaagacac gtcctacgag        60
     gatcagggct tgcgcgactt ttttctctac cgtgatttag gcattgcgca ggcaaccggc       120
     ggcaaggtgc tcgcgcaact cgtcaaggcg aatcacgcac cagagcaagg caccggctgg       180
     caccgtcatg aggccgattt ccacattgtg atcatgctga agggctgggc gcgtttcatg       240
     tacggcgaca aggagacgct cgtcgccgcc ggtgactgcg tgcatcaggc gccgggcatc       300
     gttcactatc tgttcgatta ttcggacgat atggagtaca tcgaaattgt ctcgccggcg       360
     gatttcaaat cgatcgaagt cgaagggccg tgcgacgtgc cggcggtgac gccgtggaag       420
     ggcgtcgccg cttag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page