(data stored in SCRATCH zone)

EMBL: CP000271.PE92

CP000271.PE92        Location/Qualifiers
FT   CDS_pept        103117..106968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2935"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2935"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33060"
FT                   /db_xref="GOA:Q13S79"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S79"
FT                   /protein_id="ABE33060.1"
FT                   /translation="MCKPRLTFISRERFTTYTAACGIFVFAAGLPPHYPIPSMASLNKA
FT                   SLASSMQTVRDVAQSRRTRRVITGLLIFLVVFGLLGFFAAPPLIRHVAEQQLSKQLDRP
FT                   ATIGRIALNPYTLRLEADRVHIGERGGAGDFVDISRLIVQPSWSSLFRAAPIIDQVQLD
FT                   SPRFHIVRYDAQRFNFTDLIEKFSKQPARPDSKPTLFSVSNIRLENGQITFDDKLLGAT
FT                   HVIDQWKLGIPFIATLPSKTDIFVEPLLRARIDGSPLAIDGKTKPFAASRESEVSLRFD
FT                   GLDVPRLMSYAPTRLPVIVQSGKLSTDLKLNFVVSNDAPSLRVAGTIDLNDVDVQDQGK
FT                   APFFAARAVHVAAATLDPFRNLYHFDEIRIDAPTASLARDKDGVLSVEKMFAPEPAAAQ
FT                   PAASAPVAASAANAAAKAAPPLDLAIKRFVLNDGTVNVRDNAASRPVDAGLQKLAVTLT
FT                   DFSTLATAPAHYTLNTDLKDSGGSLGVAGAFGFAAKTASAKLDLKSLNLPQLQPYLDTA
FT                   TAAQLRDGKLSATANVGANWSKLPAAVMVTDTQLDLQSLKVAAPGAKDPVIALTQGSAR
FT                   VRQVDVAARTAEIASIDTTGLAVDAERLKDGSINLAALGGRHEATPQRTAIHAVKKAQA
FT                   EGPAWHYKIGELVLKDATANFTDNTTPQPVKLNITPLQLKVQNISDDLSRPLPVDLQAT
FT                   LNRKGTLGVKGDVTATPLKVAVKVNANRLDAAAFEPYFGGKLNAVIASALLNANGDLAL
FT                   SQAKSLKATYRGDMALVDVRMLDKASSDPFAGWGSLALSSLKADYDEHGTVVDAGRVTF
FT                   TKFYGRVLLDAQGKLNLRDVVAHETGAAQSLTRDKSGADPVPLTPQAASTVAAASAPVP
FT                   ASAAAATVTAATAPQSPVKLHFGQLVLQQGRVTYTDNFIKPNFTANLVGIQGTVGAFGT
FT                   QSTTAAPVDIAAKLAANGPLSIRGTINPLIAKPALDLTAVAHDIELTNLTPYSAKYAGY
FT                   PITKGKLNVDLHYTLENDQLNANNHIFIDQLTFGDHVENDTATRLPVRLAISLLKNSRG
FT                   EIDVNLPVSGSLSNPEFSIGGLIWHAVLNLLQKAVTAPFSLIANAFGGNGEELGYVEFE
FT                   PGSATLTDADTKKLDTIVKALADKSSIRMDLIGRVDPAIDEPALRTGYVERLVKQQKIK
FT                   DVVGNGESVDLSTVTVDPKEYDKYLSKAYKSADFKKPRNFVGLTKSLPDDEMKSALAAN
FT                   APIDDASLRQLAQQRAQSVQQYLEGKIDSSRVFIVAPKLNADGIKDKGATTRVDFGLK"
     atgtgtaagc ctcgccttac atttatatcc cgcgaaagat tcacgactta tactgccgct        60
     tgcgggattt tcgttttcgc ggcgggcttg ccgccgcatt acccaatacc gagcatggca       120
     agcctcaata aagcgtcact agcctcgtcc atgcagaccg tgcgcgatgt cgcgcagtca       180
     cgccgcaccc ggcgtgtcat caccggcctg ctgatcttcc ttgtagtgtt cggtctactc       240
     ggcttctttg cggcgccgcc gctgattcgc cacgttgccg agcaacagct cagcaaacaa       300
     ctcgaccgcc ctgccacgat tggccgcatt gcgctcaatc cgtacacgct ccggctcgaa       360
     gccgaccgtg tgcatatcgg cgagcgcggc ggcgcgggcg acttcgtgga tatttcgcgg       420
     ctcatcgtgc agccgtcatg gagttcgctg tttcgcgcag cgccgatcat cgaccaggtg       480
     cagctcgatt cgccacgctt ccatattgtt cgttacgatg cacaacgctt caatttcacg       540
     gacctgatcg agaaattctc gaaacagcca gccaggccgg atagcaagcc gacgctgttc       600
     tccgtatcga acattcgcct cgaaaacggc cagatcacat tcgacgacaa gctgctcggc       660
     gccacgcacg tgatcgatca atggaagctc ggcattccgt tcatcgccac gctgccttcg       720
     aaaaccgata tcttcgtcga gccgttgctg cgtgcgcgca tcgacggcag tccgcttgcc       780
     atcgacggca agaccaagcc ctttgccgcg tcgcgcgagt cggaggtgtc gttgcgcttc       840
     gacggcctcg acgtgccgcg tctcatgtcc tacgcgccga cccggctgcc cgtgatcgtg       900
     cagtccggca aactctccac ggatctcaag ctcaacttcg tggtctccaa cgacgcgcct       960
     tcgctgcgcg tggcgggcac catcgatctg aacgacgtgg acgtgcagga tcaaggcaag      1020
     gcgccgtttt tcgcggcgcg cgcggtgcac gtggccgccg ccacgctcga cccgttcagg      1080
     aacctctatc acttcgacga gatccggatc gacgcgccga ccgccagtct cgcgcgggat      1140
     aaagacggcg tgctgagcgt cgagaagatg ttcgctcccg aaccggccgc ggcgcaaccg      1200
     gccgcgagcg cgccggttgc cgcatccgcc gccaatgccg cggcaaaagc ggcgccgccg      1260
     ctggacctgg cgatcaaacg cttcgtgctc aacgacggca ctgttaatgt tcgcgacaac      1320
     gccgcctcgc ggcctgttga cgccggcctg caaaaactgg ccgtgacgct gaccgatttt      1380
     tcgacgcttg ccacggcacc cgcgcactac acgctgaaca ccgatctcaa ggacagcgga      1440
     gggtcactcg gtgtggccgg cgcgttcggc tttgcggcga aaacggcaag cgcgaagctc      1500
     gacctgaagt cgttgaacct gccgcagttg caaccgtacc tcgataccgc gactgcggcg      1560
     cagctcaggg acggcaagct gtcggccacc gccaacgtcg gtgcgaactg gtcgaagttg      1620
     ccggcggccg tgatggtcac ggatacgcaa ctggatctgc aatcgctgaa ggtcgcggcg      1680
     cccggcgcca aggacccggt gatcgcgctc acgcaaggca gtgccagggt caggcaggtg      1740
     gacgtggcgg cgcgcaccgc cgagatcgcc agcatcgaca cgaccggcct cgcggtcgac      1800
     gccgagcgtc tgaaagacgg cagcatcaat ctcgcggcgc tcggcgggcg gcatgaagcc      1860
     acgccgcagc gtacggcgat ccacgcggtg aagaaggcgc aggcggaagg gcccgcgtgg      1920
     cactacaaga tcggcgaact ggtcctgaaa gacgccaccg ccaacttcac ggacaacacc      1980
     acgccgcagc cggtgaaact gaacatcaca ccgctgcaac tgaaggtgca gaacatcagc      2040
     gacgacctga gccgtccgct gccggtcgat ctgcaggcca cgctgaacag gaagggcacg      2100
     ctcggcgtca agggcgacgt gacggcgaca ccgcttaagg tggccgtcaa ggtgaatgcc      2160
     aaccggctcg acgcggcggc tttcgaaccg tacttcggcg gcaagctgaa tgcggtgatc      2220
     gcgagcgcgc tgctcaatgc gaacggcgat ctcgcgctga gccaggcgaa gtcgctgaaa      2280
     gcgacctatc gcggcgacat ggcgctcgtc gacgtccgca tgctcgacaa ggcgagttcg      2340
     gatccatttg cgggctgggg ctcgctcgcg ttgtccagcc tgaaggccga ttacgacgag      2400
     catggcacgg tggtcgatgc gggccgcgtc acgttcacga agttctatgg gcgtgtgttg      2460
     ctcgatgcgc agggcaagct caacctgcgg gacgtcgtcg cgcacgaaac cggcgccgcg      2520
     cagtcgctga cgcgcgacaa gagcggcgcg gaccccgtgc cgctgacgcc gcaggcggca      2580
     tccacggtcg ccgccgcatc cgcacccgtg ccggcctcgg cagcggctgc cacggtcacg      2640
     gctgccacgg cgccgcaaag cccggtcaag ctgcacttcg gacaactggt gctgcaacag      2700
     ggccgcgtga cgtacacgga caatttcatc aagccgaatt tcacggcgaa cctggtcggc      2760
     attcagggca ccgtcggtgc gttcggcacg caatccacca ccgccgcgcc ggtcgacatt      2820
     gccgcgaagc tggccgccaa tggtccgctg tcgattcgcg gcacgatcaa tccgctgatc      2880
     gcgaagccgg cgctcgatct cacggcggtc gcgcacgata tcgaactgac caatctcacg      2940
     ccgtattcgg cgaaatatgc cggctatccg atcaccaagg gcaagctgaa cgtcgatctg      3000
     cactacacgc tcgaaaacga tcaactgaat gcgaacaatc acattttcat cgatcagctc      3060
     acgttcggcg atcacgtcga aaacgatacg gcgaccaggc tgcccgtgcg cctcgcgatc      3120
     tcgctgctga agaattcgcg cggtgaaatc gacgtgaacc tgccggtgtc gggctcgctg      3180
     tcgaatcccg agttcagcat tggcggcctg atctggcatg cggtgctcaa tctgctgcag      3240
     aaggcggtga ccgcgccgtt ctcgctgatc gccaacgcat tcggcggcaa tggcgaggag      3300
     ttggggtacg tggaattcga gccaggctcg gcgacactca cggacgccga caccaaaaag      3360
     ctcgacacga tcgtgaaggc gctggccgac aaatcgtcga tccgcatgga cctgatcggc      3420
     cgcgtcgatc cggccatcga cgaacccgcg ttgcgcaccg gctatgtcga gcgcctcgtc      3480
     aagcagcaga agatcaagga cgtggtgggc aacggcgaga gcgtcgatct gtcgaccgtc      3540
     accgtggatc cgaaggagta cgacaagtat ctgagcaagg cttacaagtc ggcggacttc      3600
     aagaagccgc gcaactttgt cggcttgacg aagagcctgc cggacgacga gatgaagagc      3660
     gcgctcgccg ccaatgcgcc gatcgacgac gccagtctgc gtcagctcgc gcaacagcgg      3720
     gcgcagagcg tgcagcagta tctggaaggc aagatcgaca gcagccgcgt gtttatcgtc      3780
     gcgccgaaac tgaatgccga cggcatcaag gacaagggtg cgacgacgcg ggtggacttc      3840
     gggttgaagt ga                                                          3852
//

If you have problems or comments...

PBIL Back to PBIL home page