(data stored in SCRATCH zone)

EMBL: CP000271.PE94

CP000271.PE94        Location/Qualifiers
FT   CDS_pept        108660..109757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2933"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2933"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33062"
FT                   /db_xref="GOA:Q13S77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S77"
FT                   /protein_id="ABE33062.1"
FT                   /translation="MKTDDVIVSFRGVRKTYDGETLVVKQLDLDIYQGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIWLDGTLLNTVPPHKRNIGMVFQNYALFPHLTVEQNVAYP
FT                   LTVRKISAQERAHRTNNALKMVRMESFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKSLHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTIANVDGEYCEFRLSDGTRLTGRNIGGARAGTPA
FT                   VACIRPERMKLANGLSRPGANALAGEARGLIYFGDHVRMRCGLPQQDECFVKVPLGTDA
FT                   LDTFAPGAPVALEFAPEHLRVFAGA"
     atgaaaaccg atgacgtgat cgtcagcttt cgaggtgtgc gcaagacgta cgacggagaa        60
     acgctggtcg tcaaacaact tgatctggat atataccaag gcgaatttct gacgctgctc       120
     gggccgtccg gatcagggaa aaccacctgt ctgatgatgc tggcgggttt tgaatttccc       180
     accggcggcg aaatctggct ggacggcacg ctgctcaaca ccgtgccccc gcataagcgc       240
     aacatcggca tggtgtttca gaactatgcg ctgtttccgc atctgacggt tgaacagaac       300
     gttgcatatc cgttgaccgt gcgcaagatt tcggcgcagg aacgcgcgca tcgcaccaac       360
     aacgcgttga agatggtgcg catggagagc tttgcaaagc gctatccggc gcaactctcc       420
     ggcggccagc agcagcgtat cgcgctcgcc cgtgcgctgg tgttcgagcc gaagctcgtg       480
     ctgatggacg agccgctcgg cgcgctggac aaacagttgc gcgaacacat gcagtacgaa       540
     cttaaatcat tgcacgagaa actcggcgtg acgtttgtgt acgtcacgca cgatcagggc       600
     gaggcgctga ccatgtcgga tcgcgtggcc gtgttcgaca aaggcatcgt gcagcaactc       660
     gataccgtcg atcgtctgta cgaatcgccg tgcaacgagt tcgtggcgaa ctttatcggc       720
     gacagcaaca ggctgcgcgg cacgatcgcg aatgtcgatg gtgagtattg cgaattccgg       780
     ttgagcgacg gcacgcgtct tactgggcgc aacatcggcg gggcgcgggc gggcacgccg       840
     gcggtcgcgt gtattcggcc cgagcgcatg aagctcgcca acggcctgtc acggcccggc       900
     gccaatgcgc tcgccggtga ggcgcgcggg ctgatctatt tcggcgacca cgtgcgcatg       960
     cgctgtggtt tgccgcaaca ggacgagtgc ttcgtcaagg tgccgctcgg caccgacgcg      1020
     ctcgacacct tcgcgcccgg cgcgccggtc gcgctggagt tcgcacccga gcatctgcgg      1080
     gttttcgcgg gagcgtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page