(data stored in SCRATCH zone)

EMBL: CP000271.PE95

CP000271.PE95        Location/Qualifiers
FT   CDS_pept        109867..110916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2932"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33063"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S76"
FT                   /protein_id="ABE33063.1"
FT                   /translation="MSKIGKSRCAIAVGAVALALGAAQVNAAELTVVNFGGANGDAQKV
FT                   AFNQPFEKETSNKVTAVEYNGEQAKVKAMVEARHVNWDVVEVESGDIGRGCDEGLYEKL
FT                   DWSKIGKKSDLIPEAPQTCGVGFFVWSTALAYNADKLKTAPAGWADFWDVKKFPGKRAM
FT                   RKGARYNLEFALMADGVPPKDVYKVLATKAGQDRAFKKLDELKPNIQWWEAGAQPPQFL
FT                   VAGDVVMSTAYNGRIDAAQKEGKNLKVVWNGSIYDLDYWAIPKGTPNKALAEKYIAYSI
FT                   SSKPQQDYAHNIAYGPVNVTAIKALDPKTLANLPNSPANGKNAVLQDLAFWTDHGDELE
FT                   QRFSSWASK"
     atgagcaaga tcgggaaatc gcgctgcgcc atcgctgttg gtgccgtggc gctcgcgctg        60
     ggcgccgcgc aagtcaatgc cgccgaattg acggtcgtca atttcggcgg tgcaaatggc       120
     gatgcgcaaa aggtcgcttt caaccagccg ttcgaaaagg agaccagcaa taaagtcacc       180
     gctgtcgaat acaacggcga gcaggccaaa gtgaaagcga tggtcgaagc caggcacgtg       240
     aactgggacg tggtggaagt cgaatcgggc gatatcggcc gcggctgtga tgaagggctg       300
     tacgagaaac tcgactggtc gaagatcggc aagaagtcgg atctgattcc tgaagcaccg       360
     caaacctgcg gcgtgggctt cttcgtgtgg tcgacggcac tcgcgtataa cgcggacaag       420
     ctgaaaacgg caccggccgg ctgggccgat ttctgggacg tcaagaaatt cccgggcaag       480
     cgcgccatgc gcaagggcgc gcgctacaac ctcgaattcg cgttgatggc cgacggcgtg       540
     ccgccgaagg acgtctacaa ggtactcgcc accaaggcag gccaggaccg cgcgttcaag       600
     aagctcgacg agctgaagcc gaacattcag tggtgggaag cgggcgcgca gccgccgcaa       660
     ttcctcgtgg cgggcgacgt ggtgatgtcc accgcgtaca acggccggat cgacgccgcg       720
     cagaaggaag gcaagaacct gaaggtggtg tggaacggca gcatctacga cctcgactac       780
     tgggcgattc cgaagggcac gccgaacaag gcgctggccg agaagtacat tgcctattcg       840
     atttcgtcga agccgcagca ggactacgcg cacaacatcg cgtacggccc ggtgaacgtg       900
     acggccatca aggcgctcga tccgaagacg ctcgccaatc tgccgaactc gccggccaac       960
     ggcaagaacg cggtgctgca ggacctcgcg ttctggaccg atcatggcga cgagctggag      1020
     cagcgttttt cgtcgtgggc ttcgaagtaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page