(data stored in SCRATCH zone)

EMBL: CP000271.PE96

CP000271.PE96        Location/Qualifiers
FT   CDS_pept        110992..112260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2931"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2931"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33064"
FT                   /db_xref="GOA:Q13S75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S75"
FT                   /protein_id="ABE33064.1"
FT                   /translation="MTIAADSTPESSGRLKRELRAAESRKRAVALLLIAPLAIFLLLIF
FT                   VVPIGALLTRAAQNPEVVNALPHTLTALSAWDRKTPPPDAAYVALATDLAAVADSDGMG
FT                   ALARRLNVEIPGYRSLIAKSARAMPFVDDNSKPLQLTPAQVHAKFVELDERWNDIAYWQ
FT                   TIAKNSSAYSPFYLLASLDHKQDAFGHVIPTDPEQQIYLAVFSRTFVIGAAVTFFALLL
FT                   GYPLAYWISTLPERRANLVMILVLIPFWTSILVRVAAWIVILQSEGLVNKALIGSGLLH
FT                   DPLSLLFNRTGVYISMTHILLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYV
FT                   PQTYPGIGAGALLVFILAIGYYITPALLGGPNDQMVSYYVAYYTNVTINWGMACALGGL
FT                   LLAATLVLYVIYGRFTRSSLSLG"
     atgaccatcg ctgccgattc gacgcctgaa tcaagcggcc ggctcaagcg cgagttgaga        60
     gccgcggagt ccagaaagcg ggccgtggcc ctgctgctga tcgcaccgct cgcaatcttt       120
     ctgttattga ttttcgtcgt gccaatcggc gcgctgctca cgcgcgccgc gcagaatccc       180
     gaagtcgtca acgcactgcc gcatacgctg acggcattga gcgcgtggga ccgcaagacc       240
     ccgccgccgg atgccgcgta tgtcgccctc gctaccgacc tcgccgcggt cgccgacagc       300
     gacggcatgg gcgcgctcgc gcgccgcctg aacgtcgaga ttccgggtta tcgctcgctg       360
     atcgccaagt cagcgcgcgc catgccgttc gtcgacgaca acagcaaacc cttgcaactg       420
     acgcctgccc aggtccacgc caaattcgtc gagctggacg aacgctggaa cgatatcgcc       480
     tactggcaaa ccattgcaaa aaattcgagc gcgtactcgc cgttctatct gctcgcttcg       540
     ctggatcaca agcaggacgc gttcggccac gtcattccga ccgatcccga gcaacagatc       600
     tatctcgccg tgttcagccg cacctttgtg atcggcgcgg cggtgacctt cttcgcgctg       660
     ctgctcggct acccgctcgc atactggatt tcgacgctgc ccgaacgtcg cgcgaatctg       720
     gtgatgattc tcgtgctgat tccattctgg acctcgattc tcgtgcgcgt ggcggcgtgg       780
     atcgtgattc tgcaaagcga agggctggtg aacaaggcgt tgatcggcag cgggctgctg       840
     catgatccgc tgtcgttgct gttcaaccgc accggcgtct acatttcgat gacgcatatt       900
     ctgctgccgt tcatgatcct gccgctctat agcgtgatga agtcgatccc gccgacctat       960
     cagcgcgccg cggtctcgct cggcagccat ccgttcgccg cgttctggcg cgtgtacgtg      1020
     ccgcaaacct atccgggcat cggcgcgggc gcgttgctgg tgttcattct ggcgatcggc      1080
     tattacatta cgccggcgtt gctgggtgga ccgaacgatc agatggtcag ctactacgtc      1140
     gcgtactaca ccaacgtgac gatcaactgg ggcatggcgt gcgcgctcgg cggcttgctg      1200
     ctcgccgcga cgctcgtgct gtacgtcatt tacgggcgct tcacgcgttc gtcattgagc      1260
     ctcggctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page