(data stored in SCRATCH zone)

EMBL: CP000271.PE97

CP000271.PE97        Location/Qualifiers
FT   CDS_pept        112275..113114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2930"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2930"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33065"
FT                   /db_xref="GOA:Q13S74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S74"
FT                   /protein_id="ABE33065.1"
FT                   /translation="MKLAKPLFAPHTSWVERVWYFALRGLAVLTLLYLILPVLAIVPLS
FT                   FSSSTFLVYPIPGWSLRWYQNLIASDEWRMAARNSFIVAPSATVVATVLGTLAAIGLTK
FT                   ANFRGKGLLMAILISPMIVPVVVVGVGMYLFFAPLGLANTYIGLILAHASLGVPFVVTT
FT                   VAATLQGFNYNLVRASLSLGANPVKTFFRITLPVIAPGVISGALFAFATSFDEVVVTLF
FT                   LAGADQTTLPRQMFTGIRENISPTIAALATILIIFSTSLLLALEWLRGRNAARAVRA"
     atgaaacttg ccaagccatt gttcgcgccg catacgtcgt gggtggagcg cgtctggtat        60
     ttcgcgctgc gcggtctcgc cgtgctgacg ctgctgtatc tcatcttgcc ggtgctggcg       120
     atcgtaccgc tgtcgttttc gtcgagcacg ttcctggtgt atccgattcc gggctggtcg       180
     ctgcgctggt atcagaacct gattgcatcc gacgaatggc gcatggccgc caggaacagc       240
     tttatcgtcg cgccttcggc gacggtggtc gcgaccgtgc tcggcacgct ggcggcaatc       300
     ggcctgacca aagcgaattt ccgcggcaaa gggttgctca tggcgatcct gatttcgccg       360
     atgatcgtgc cggtggtggt ggtcggcgtg ggcatgtatc tgttctttgc gccgcttgga       420
     ctggccaata cgtatatcgg cctgattctc gcgcatgcgt cgctcggtgt gccgtttgtc       480
     gtgaccacgg ttgcggcgac gttgcagggt ttcaactaca acctggtgcg cgcgagtttg       540
     tcgctgggtg cgaatccggt gaagacgttt ttccgcatca cgttgccggt catcgcgccg       600
     ggcgtgatct cgggcgcgct gttcgcgttc gcgacttcat tcgatgaagt cgtcgtgacc       660
     ctgttcctcg cgggcgcgga tcagactacg ctgccccggc agatgtttac cggcattcgg       720
     gaaaacatca gcccgaccat cgccgcgctg gcgaccattc tgattatctt ttcgaccagc       780
     ctgttgctgg cgctcgagtg gctgcgtggg cgaaatgcag cacgggcggt cagggcttga       840
//

If you have problems or comments...

PBIL Back to PBIL home page