(data stored in SCRATCH zone)

EMBL: CP000271.PE98

CP000271.PE98        Location/Qualifiers
FT   CDS_pept        113271..114350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2929"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33066"
FT                   /db_xref="GOA:Q13S73"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S73"
FT                   /protein_id="ABE33066.1"
FT                   /translation="MKHQLTVLVCALALTACADHAARERLGIEDATLLKTGFGATQDEA
FT                   AGAVNAQWVSTYAPIASSNTALAGLQTRLDRLPGDKNSYFYAKAQCWINAAQQARQAND
FT                   RWGFVEEAIGQAATITIGLENGAPLSAANPALRTVSTVRPDLWKIVNTIKADPAVAQCP
FT                   QAQQPLACAEVELAQAGHDAWRRSFTNAEKRLPEVQDNLRQSAQRALQCKQALQAPASM
FT                   SAPEQGSVAKPQQKITLKADSLFRFNGGDEAAMLPAGKRQLDDVATGLNNAPALHELKI
FT                   TGYADRLGDKSYNLGLSMQRARTVERYLRAHGVSVPITAQGRGSANPLVDCRRTKRDAL
FT                   VKCLAPNRRVEIELVAARS"
     atgaaacacc agctaacggt gcttgtgtgc gcgctggcct tgacggcctg cgcggaccac        60
     gccgcgcgtg aacgactcgg catcgaagat gccacattgc tgaaaaccgg tttcggcgct       120
     acgcaggacg aagccgcagg cgcggtcaac gcgcaatggg tcagcaccta cgcacccatc       180
     gcaagcagta atacggcgct ggccggcctg cagacgcggc tcgaccgcct gccgggcgat       240
     aagaacagct atttttacgc caaagcacaa tgctggatca atgccgccca acaggcgcgg       300
     caagctaatg accgttgggg attcgtcgag gaggcaatcg gccaggcggc caccatcaca       360
     ataggcctcg agaacggcgc gccgctatcc gctgccaatc ccgcactgcg caccgtatcc       420
     acggtgcgcc ccgatctgtg gaagatcgtc aataccatca aggcggatcc tgcggttgct       480
     caatgcccgc aggcacagca gccgctcgcg tgcgccgaag tcgaactcgc gcaagccggg       540
     catgatgcat ggcgccgcag cttcaccaac gccgagaaac gcttgcccga ggtgcaggac       600
     aacttgcgcc agtcggcgca aagagcgctg caatgcaagc aggcgcttca ggcgcccgca       660
     tccatgtccg cgccagagca aggttctgtt gccaaaccgc agcaaaagat cacgctgaag       720
     gccgattccc ttttccgttt caacggcggc gacgaagccg ccatgctgcc cgccggcaag       780
     cgccagctcg acgacgtggc aacaggtctg aacaacgctc ccgcgctgca tgaactgaag       840
     atcaccggct acgccgaccg cctcggcgac aagtcataca acctcggttt gtccatgcag       900
     cgtgcacgga cggtcgagcg atatctacga gcgcatggcg tgagcgtgcc gatcactgcg       960
     caaggcagag gcagcgcgaa tccgctggtc gactgccgcc gaacaaagcg cgatgccctg      1020
     gtgaaatgcc tcgcgccgaa tcgccgcgtc gagatcgaac ttgtcgcggc gcgttcctag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page