(data stored in ACNUC7421 zone)

EMBL: CP000271.PQQB

CP000271.PQQB        Location/Qualifiers
FT   CDS_pept        complement(659943..660863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="Bxe_B2467"
FT                   /product="Pyrroloquinoline quinone biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33524"
FT                   /db_xref="GOA:Q13QW5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW5"
FT                   /protein_id="ABE33524.1"
FT                   /translation="MKIKVLGSSAGGGFPQWNCNCRNCDGVRRGTIKATRRTQSSIAVS
FT                   ANGEDWLLVNASPDLLAQIAANPELQPARRARDSGIAAVLVIDAQIDHVTGLLMLRERD
FT                   TPLPLYATNAVWQDLCSGFPVAPILSHYCGVEHRRIALDGAPLAIDALGGVQIDALPLS
FT                   SKAPPYSPHRNAPERGDNIGLVITNRQTGKRVFYAPGLGAIEAHVLAAMREADLLLVDG
FT                   TLWTADEMIRLELSKKTAADMGHLQQSGPGGMIEVLDSLGAHNARKVLIHINNTNPILV
FT                   EDGPERRILTEHGIEVAYDGMTFEI"
     atgaaaatca aggtactcgg ctcatcggcg ggcggcggtt tcccgcaatg gaactgcaat        60
     tgccgcaatt gcgacggcgt gcggcgcggc acgatcaagg cgacgcgccg cacgcaatcg       120
     tcgatcgcgg tgagcgcgaa tggcgaggac tggctgctcg tcaacgcatc gcccgatctg       180
     ctcgcacaga tcgccgccaa tccggaattg cagccggccc gccgcgcgcg cgacagcggc       240
     attgccgcgg tgctggtcat cgacgcgcag atcgatcacg tgaccggcct gctgatgctg       300
     cgcgaacgcg acacgccgct gccgctctat gcgactaatg cggtatggca ggacctgtgc       360
     agcggttttc cggttgcgcc gatcctctcg cactattgcg gcgtcgagca tcggcgtatc       420
     gcgctcgacg gcgcgccgtt agcgatagat gcgctcggcg gcgtgcagat cgacgcgctg       480
     ccgctgtcga gcaaggcgcc gccctattcg ccgcaccgca acgcacccga gcgcggcgac       540
     aacatcggac tcgtcatcac gaaccggcag accggcaagc gcgtgttcta tgcgcccgga       600
     ctcggcgcga tcgaagcgca cgtactcgcg gcgatgcgcg aggccgatct gctgctcgtc       660
     gacggcacgc tgtggaccgc cgatgaaatg atccgcctgg aactttcgaa gaagactgcg       720
     gccgacatgg gccatctgca gcagtccggc cccggcggca tgatcgaggt gctggactcg       780
     ctcggcgcgc acaatgctcg caaggtgctc attcacatca acaacaccaa cccgattctc       840
     gtggaggacg gccccgagcg ccgcatcctg accgagcacg gcattgaagt ggcgtatgac       900
     ggaatgacgt tcgagatctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page