(data stored in SCRATCH zone)

EMBL: CP000272.NAPA

CP000272.NAPA        Location/Qualifiers
FT   CDS_pept        392156..394639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="Bxe_C0367"
FT                   /product="periplasmic nitrate reductase subunit NapA
FT                   apoprotein"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36274"
FT                   /db_xref="GOA:Q13I15"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13I15"
FT                   /protein_id="ABE36274.1"
FT                   /translation="MTLSRRAFIKQTAAATAASAAGVVLPGVDALAASDSLTWSKAPCR
FT                   FCGTGCGVSVGVKNGKVVATQGDPQAEVNRGLNCVKGYFLSKIMYGQDRLTTPLLRMKD
FT                   GKYAKDGEFAPVSWDQAFDVMADHFKRTLKEKGPTAVGMFGSGQWTVWEGYAAVKLMKA
FT                   GFRSNNLDPNARHCMASAVTGFMRTFGMDEPMGCYDDIEQADTFVLWGSNMSEMHPILW
FT                   TRITDRRLSTPTTRVVVLSTFEHRSFDLADQTIIFTPQSDLAILNYIANYIIRNGNVNR
FT                   DFVNRHTVFKQGNADIGYGLRPDNPLQKTARNAGDPNGSQPITFDEFAKFVSKYDAAYV
FT                   TKLSGVPQNKLDQLARLYADPKVKVMSFWTMGFNQHTRGTWANNMVYNLHLLTGKIATP
FT                   GNSPFSLTGQPSACGTAREVGTFSHRLPADMVVTNPKHREEAEHIWKLPAGTIPDKPGY
FT                   HAVLQNRMLRDGKLNAYWVQVNNNVQAAANINGEALPGYRNPQAFVVVSDVYPTVTAVA
FT                   ADLILPSAMWVEKEGAYGNAERRTQFWHQLVDAPAGARSDLWQLVEFSKRFKVEEVWPA
FT                   DLLAKKPEYRGKTLYDVLYRNGQVDRFALTETDSHYRNDEAKAFGFYIQKGLFEEYASF
FT                   GRGHGHDLAPFDAYHKARGLRWPVVNGKETRWRYKEGSDPYVKTGTGWQFYGNPDGRAV
FT                   IYALPYEPPPEVPDKEYPFWLATGRVLEHWHSGSMTRRVPELYRAFPNAVCFMHPDDAK
FT                   AMGVRRGVEVKVMSRRGYILTRVETRGRDKPPRGLVFVPWFDSSQLINKVTLDATDPIS
FT                   LQTDYKKCAVKIVKV"
     atgacgctgt cccgtcgcgc gtttattaag cagaccgccg cggccacggc cgcttcagcg        60
     gcaggggttg tgctgccggg cgtggacgcc ctggctgcgt cggacagcct gacctggtca       120
     aaggctccgt gccgattttg cgggaccggc tgcggtgtca gcgtgggcgt gaagaacggc       180
     aaggttgtgg caacccaggg tgacccgcag gccgaggtca atcggggcct caactgcgtg       240
     aaaggctact tcctgtcgaa gattatgtac ggccaggatc gtctgaccac accgctgctg       300
     cgcatgaaag acggcaagta tgccaaggac ggcgaattcg cgccggtctc gtgggatcag       360
     gccttcgatg taatggccga tcacttcaag cgcaccctga aagaaaaggg cccgacagca       420
     gtgggaatgt ttggctcggg acagtggacg gtgtgggagg gctacgctgc cgtcaaactt       480
     atgaaggcgg gctttcgcag caacaatctc gaccccaacg cgcgtcactg catggcctcg       540
     gccgtcaccg gcttcatgcg cacgttcggt atggacgagc caatgggctg ctatgacgat       600
     atcgagcagg ctgatacctt cgtgctgtgg ggctccaaca tgtcggagat gcatcccatc       660
     ctgtggaccc gcattaccga ccgccggctc agcacgccca cgacgcgcgt ggtcgtgctc       720
     tcgaccttcg agcatcgcag cttcgatctg gccgaccaga cgattatttt tacaccgcaa       780
     tcagatctgg cgattctgaa ctacatcgcg aattacatca tccgcaacgg caacgtgaat       840
     cgcgatttcg tcaacaggca tacggttttc aagcaaggca acgccgacat cggttatggc       900
     ctgcggcccg acaacccgtt gcagaaaacg gccaggaatg cgggcgaccc aaatggttcg       960
     cagccgatta cgttcgacga atttgcgaaa ttcgtctcga agtatgacgc ggcctatgtg      1020
     acgaagctct caggtgtgcc gcaaaacaag ctcgatcaac ttgcccggct gtatgctgat      1080
     ccgaaggtca aggtgatgtc gttctggacc atgggcttca accagcacac gcgtggcacg      1140
     tgggccaaca acatggtcta caacctgcat ctgctgaccg gcaagatcgc cacgcccggc      1200
     aacagtccgt tttcgctgac ggggcagccg tccgcatgcg gtacggcgcg cgaagtgggg      1260
     accttttcgc accggctgcc ggccgacatg gtggtcacca acccgaagca tcgtgaggag      1320
     gccgagcata tctggaaact gccggcaggc acgattccgg acaaaccggg ctatcacgca      1380
     gtcctgcaga accgcatgct gcgcgacggc aagctcaacg cctactgggt gcaggtgaac      1440
     aacaacgtgc aggctgctgc caatatcaat ggagaagcgt tgccgggtta tcggaatcca      1500
     caagccttcg tggtggtgtc ggatgtgtat cccacagtca ccgcggtggc ggcagacctg      1560
     atcctgccct cggcgatgtg ggttgaaaag gagggcgcgt acggcaacgc cgagcggcgc      1620
     acccagttct ggcatcaact ggtcgacgca ccggccggcg cccgctccga cctgtggcaa      1680
     ctggtcgagt tttcaaagcg cttcaaggtc gaagaagtct ggcctgcgga tttgctcgcg      1740
     aagaagccag agtacagggg caagacgctc tacgacgtgc tgtatcgtaa cggccaggtc      1800
     gacaggtttg cccttacgga aactgattcc cactatcgga acgacgaagc caaggcgttt      1860
     ggtttctaca ttcagaaggg cctgttcgag gagtacgcaa gcttcggccg tggccatggc      1920
     catgatctcg cgccattcga cgcgtatcac aaggcgcgcg gtctgcgctg gccggtggtc      1980
     aacggaaagg aaacgcgctg gcgctataag gaaggttccg atccttacgt gaaaacaggc      2040
     accggctggc agttctacgg caatcccgat ggccgcgcgg tgatctatgc gctgccttac      2100
     gagccacccc cagaagttcc ggacaaggag tatccattct ggctcgctac cggtcgtgtg      2160
     ctggaacatt ggcactcggg ttcgatgacg cggcgcgtgc ccgagctgta ccgcgcgttt      2220
     ccaaatgcgg tgtgcttcat gcatcccgac gacgcgaaag caatgggtgt gcggcgcgga      2280
     gtagaggtca aggtaatgtc gcggcgcggc tacatcctga cgcgggtcga gacgcgcgga      2340
     cgtgacaagc cgccgcgcgg gctggtcttc gtgccatggt tcgattcaag ccagttgatc      2400
     aacaaggtga cgctggacgc aactgacccg atctcgctac agaccgacta caagaagtgc      2460
     gcggtcaaga tcgtcaaggt atag                                             2484
//

If you have problems or comments...

PBIL Back to PBIL home page