(data stored in ACNUC7421 zone)

EMBL: CP000272.PE103

CP000272.PE103       Location/Qualifiers
FT   CDS_pept        117852..118823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0105"
FT                   /product="ABC aliphatic sulfonates transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36031"
FT                   /db_xref="GOA:Q13IQ8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ8"
FT                   /protein_id="ABE36031.1"
FT                   /translation="MTRHSSPGRRHFIEAGLALALASAIPGAHAQGGASSARVLRIGYQ
FT                   KGPFSILKGRGTLDKRLAALGTRVEWTEFPSGPPQLEALNVGSIDFGDVGEAPPIFAQA
FT                   AGAPFVYYGQTAKRPVSEAVVVPDDSPVTSFSELKGKRIALVKGSNTHFLLVRLLAAAK
FT                   IDYRDVTPVWLSPSDARAAFERKAVDAWAIWDPFLAVAQKTANARIIADGSGVVANRAF
FT                   YFTSHNYVQKNDDVLRVVLGEIGALDKWVEANRSEAAGEFAQLWGVPREIVEVALARLQ
FT                   YGVEPISRETLADQQRIADAFYELKLLPKRIEVAHAAPPSLA"
     atgacgcgtc attcatcacc aggccgccgc catttcattg aggccgggct cgcgctggct        60
     ctcgcctccg cgatccccgg cgcgcacgcg cagggcggcg cgagttcggc acgcgtgctg       120
     cggatcggct atcagaaggg gccgtttagt attctcaaag gtcggggcac attggataag       180
     cggctcgcgg cgcttggcac gcgagtcgaa tggaccgaat ttccttccgg accgccgcaa       240
     ctcgaggcgc tcaacgtcgg ctcgatcgac ttcggcgacg tcggcgaggc gccgccgatc       300
     ttcgcgcagg ctgcgggcgc gccgtttgtc tactacggac agaccgcaaa gcggccggtc       360
     agcgaagcgg tggtcgtgcc ggacgattcg ccggttacgt cgttctccga actgaagggg       420
     aaacggatcg cgctcgtcaa gggctccaac acgcactttc tgctggtacg cctgctcgcc       480
     gccgccaaaa tcgattaccg cgacgtgaca cccgtgtggc tgtcgccgtc cgacgcgcgc       540
     gcggcattcg agcgcaaggc ggtcgacgca tgggcaatct gggatccgtt tctcgcggtc       600
     gcgcagaaaa cggcgaatgc gcggatcatt gccgacgggt cgggcgtcgt cgccaatcgt       660
     gcgttctatt tcacgtcaca caattacgtg caaaagaacg acgacgtgtt gcgtgtagtg       720
     ctgggcgaga tcggcgcgct cgacaaatgg gtcgaggcga atcgcagcga agcggccggt       780
     gagttcgccc agctatgggg agtgccgcgc gagatcgtcg aggtagcgct cgcgcgcttg       840
     caatacggcg tcgagccgat ttcgcgcgaa accctggcgg accagcagcg catcgccgac       900
     gctttctatg agctgaaact gctgccgaag cggatcgaag tggcgcatgc ggcgccgccg       960
     tcgcttgcct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page