(data stored in ACNUC7421 zone)

EMBL: CP000272.PE107

CP000272.PE107       Location/Qualifiers
FT   CDS_pept        complement(123359..123634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0110"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36035"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ4"
FT                   /protein_id="ABE36035.1"
FT                   /translation="MAEVVSDNHQRRIYRLGVPDDDALAGETARLIARQGGDNGIRALS
FT                   LNAATARRFTRYFEHLSSADGNNLPLAGRVIAAGVVPDDKYCGPAA"
     atggcagagg tcgtgagtga caatcatcaa cggcgcattt accgcctcgg tgtccccgat        60
     gacgacgcgt tagccggaga gaccgcgcga ctcatcgcgc ggcaaggcgg cgacaacggg       120
     atccgcgcgc tttcgctaaa tgcggctacc gcacgccgtt tcacccgtta tttcgagcat       180
     ctctccagcg cggacggcaa caacctgccg cttgccgggc gcgtcattgc cgccggtgtc       240
     gtgccggacg acaagtattg cggtccggcg gcgtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page