(data stored in ACNUC7421 zone)

EMBL: CP000272.PE113

CP000272.PE113       Location/Qualifiers
FT   CDS_pept        130039..130869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0116"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36041"
FT                   /db_xref="GOA:Q13IP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP8"
FT                   /protein_id="ABE36041.1"
FT                   /translation="MVAVPEVLNQSAAASPVRDAARIDVRHVSHRFALRGAALPVLQDV
FT                   SFTVEPGEFVALLGPSGCGKSTLLRLVAGLDAPTQGSVHANGAAITGPDPSRVVVFQDP
FT                   TLYPWRTVRGNVAIGPQAQRRRFARRDAAQEDHARQRIDAALELVGLSEFAEAFPHQLS
FT                   GGMAQRVALARALVNDPALLVLDEPFGKLDSLTRIRMQGELARLWQDARFSVLLVTHDV
FT                   EEALLLANRVIVFSERPARVVAEVRNDAPYPRHRDDPKLVALRREVLAQLGLDT"
     atggtagccg tacccgaagt gctgaatcag tccgccgccg cttcgccggt gcgcgatgcc        60
     gcgcgcatcg acgtacgcca cgtcagccat cgctttgcgt tgcgcggcgc ggcactgccg       120
     gtgttgcagg acgtcagctt tacggtggag ccgggcgagt tcgtcgcgct gcttggcccg       180
     agtggttgcg gcaagtccac tttgctgcgg ctcgtggccg ggctcgacgc gccgacccaa       240
     ggcagcgtgc acgccaatgg cgctgcgatt acgggtcccg atccgtcgcg cgtggtcgtg       300
     ttccaggatc cgacgttgta tccgtggcgt acggtgcgcg gcaatgtcgc gatcggtccg       360
     caggcacagc gccgtcgctt tgcccggcgc gacgcggcgc aggaagatca cgcgcggcaa       420
     agaattgacg ccgcactgga actggtcggt ctcagcgaat tcgccgaagc gtttccgcat       480
     caattgtcag gcggcatggc gcagcgcgtc gcgttggctc gcgcgctcgt caatgatccg       540
     gcgttgctgg tgctggacga gccgttcggc aagctcgatt cgctgacacg catccgcatg       600
     caaggcgaac tggcgcggct gtggcaggac gcccgctttt ccgtgctgct ggtgacgcac       660
     gacgtggaag aagcgctgct gctcgccaac cgcgtgatcg tcttcagcga gcgcccggca       720
     cgggtcgtcg ccgaagtgcg caacgacgcg ccgtatccgc gccatcgcga cgatccgaaa       780
     ctggtggcgc tgcgtcgcga ggtgctggcg caacttggac tcgacacctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page