(data stored in ACNUC7421 zone)

EMBL: CP000272.PE120

CP000272.PE120       Location/Qualifiers
FT   CDS_pept        136115..137047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0123"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36048"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP1"
FT                   /protein_id="ABE36048.1"
FT                   /translation="MTATVGGLTALGDTAARQLANATKTVPQLATITPRWLTHLLQWLP
FT                   VEAGIYRLNQVKNPEAVVAACTAREDESILPRTFVPYEEQPREYFLNAVSTVLDVHTRI
FT                   SDLYSSPHDQIKEQLRLTIETIKELQESQLINNPDYGLLANVAEEQRVFPLTGAPTPDD
FT                   LDELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDK
FT                   VPVADGKTKILLLRVGDKRQGVVGLFQPGVAGEQGPGLSVRFMGINNHAIASYLISLYC
FT                   SLAVHSPDALAVLDDVEIGKYHDYPDTYK"
     atgacagcaa ctgtgggcgg cctgacggcg ctcggcgata ccgcagcacg gcaactagcg        60
     aatgccacca aaaccgttcc gcaacttgcc acgatcacgc cgcgctggct gacgcatctg       120
     ctgcaatggc tgccggtcga agcgggcatt tatcgcctga atcaggtgaa gaatcccgaa       180
     gccgtggtgg cggcctgcac cgcgcgcgag gacgaaagca ttctgccgcg cactttcgtg       240
     ccatacgaag agcagccgcg cgaatacttc ctgaatgcgg tcagcaccgt gctcgacgtg       300
     catacgcgca tttccgatct gtatagcagc ccgcacgacc agatcaagga gcaactgcgc       360
     ctgacgatcg agacgatcaa ggaactgcag gaaagccagc tgatcaacaa ccccgattac       420
     ggcttgcttg cgaatgtggc agaggagcag cgcgtgtttc cgctgaccgg cgcgccgacg       480
     cccgacgatc tcgacgagct gctgacgaag gtatggaagg agccggcgtt cttcctgacc       540
     catccgctgg caatcgctgc gttcggccgc gaatgcacgc gccggggcgt gccgccgccg       600
     accgtgagcc tgttcggttc gcagttcctg acgtggcgtg gcattccgct gattccgtcg       660
     gacaaggtgc cggtcgccga cggcaagacc aagatcctgc tgctgcgcgt gggcgacaag       720
     cgccagggcg tagtcgggct gttccagccg ggcgtggccg gcgaacaggg gccgggcctg       780
     tcggtccgct tcatggggat caacaatcat gcgatcgcct cttacctgat ctcgctgtac       840
     tgctcgcttg ccgtgcattc gccggatgcg ctggcggttc tcgatgacgt ggagatcggc       900
     aagtaccatg actacccaga cacctacaag taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page