(data stored in ACNUC7421 zone)

EMBL: CP000272.PE126

CP000272.PE126       Location/Qualifiers
FT   CDS_pept        142945..143640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0129"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36054"
FT                   /db_xref="GOA:Q13IN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN5"
FT                   /protein_id="ABE36054.1"
FT                   /translation="MSAVDWLPILRYLLAGAFPNGPLGGIALTVMLTLTSAALSALLGL
FT                   AGGVSLVMTRGLPHLLLLAVVGLFRAIPVLMLIFWTFFLMPVLLHVDVPGLATVVCALA
FT                   LIGGAYLSHSVQAGIVAVGDGQWQAAQSLGMTRGQALRHVLLPQAIRTMTPSFVNQWVS
FT                   LIKDTSLAYIVGVPEFTFLANQVNSRLMVYPAQIFLFVGLVYLVLCCTFQWGVTRLLSG
FT                   AFDAGAARR"
     atgagcgcag tggactggct gccgatcctg cgctatctgc tcgccggcgc gtttcccaat        60
     ggcccgcttg gcggcatcgc gctgaccgtg atgctgacgc tgacgtcggc cgcgctgtcg       120
     gcgctgctcg gccttgcagg cggcgtctcg ctggtgatga cgcggggctt gccgcatctg       180
     ctgctgctcg ccgtggtggg cttgtttcgc gcgattccgg tgctgatgct gatcttctgg       240
     acgttctttc tgatgccggt gctgctgcat gtcgacgtcc caggactcgc gaccgtggtg       300
     tgcgcgctcg cgttgatcgg cggcgcgtat ctgtcgcatt cggtgcaggc cggtattgtc       360
     gcggtcggcg atgggcaatg gcaggccgcg cagtcgctcg gcatgacgcg cggccaggcg       420
     ctgcgccatg tgctgctgcc tcaggcgata cgcacgatga cgccgtcgtt cgtcaaccaa       480
     tgggtgtcgt tgatcaagga cacctcgctc gcctatatcg tcggcgtgcc ggaattcacg       540
     tttctggcca atcaggtgaa cagccgcctg atggtttatc cggcgcagat attcctgttc       600
     gtcggtctgg tatatctcgt gttgtgctgc acttttcagt ggggcgtcac acgtctgctg       660
     agcggcgcgt tcgacgcggg tgcagcgcgc cgataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page