(data stored in ACNUC7421 zone)

EMBL: CP000272.PE127

CP000272.PE127       Location/Qualifiers
FT   CDS_pept        complement(143707..144117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36055"
FT                   /db_xref="GOA:Q13IN4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN4"
FT                   /protein_id="ABE36055.1"
FT                   /translation="MSESKRQIRPGAFLMETGHHIAAWRHPDMHASGGPDFQHYVQLAR
FT                   IAERAKFDVIFFANSVSVREKEEGTDGFNVMPPWLPGGLSAFTEQIVPELQRRGLFRTE
FT                   YEGRTLRENPGLPRPVNRHVLAGKNAAAVAAR"
     atgagcgaaa gcaaacggca gatcaggcca ggcgcctttc tgatggagac cggccaccat        60
     atcgccgcat ggcggcatcc cgacatgcat gcgagcggcg gacccgattt ccagcactat       120
     gtacagctcg cgcggattgc agagcgcgcg aagttcgacg taatcttttt cgccaacagc       180
     gtcagcgtgc gcgagaagga agaaggaacg gacggtttca acgtcatgcc gccgtggctt       240
     cccggcgggc tcagtgcatt caccgaacag atcgtgccgg aattgcagcg gcgtggactg       300
     ttccgaaccg aatacgaggg gcgcacgctg cgtgaaaatc ccggactgcc gcggccggtg       360
     aatcgccatg tgctggcagg aaaaaacgcg gcagcggtcg ccgcccggta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page