(data stored in SCRATCH zone)

EMBL: CP000272.PE128

CP000272.PE128       Location/Qualifiers
FT   CDS_pept        complement(144167..145012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0131"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36056"
FT                   /db_xref="GOA:Q13IN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN3"
FT                   /protein_id="ABE36056.1"
FT                   /translation="MTLATSEGLDIRHVRKRYVQRGTALDVLDDITLRVRPGEFISVLG
FT                   ASGCGKSTLLRLIAGLDTDYSGDIFVAGERVRDTSLQRGIVFQDHRLFPWLTASQNILA
FT                   ALRNAPLTAKQKRDAVAEHIALVGLAGFENAYPNQLSGGMAQRVAIARGLVNRPRVLLL
FT                   DEPFGALDALTRGRLQNELQRIWEQERITMILVTHDVDEAVYLGDRVVTMAPRPGRIKR
FT                   IVDVGLPRPRKRGDARFLRLRDEIVADFGESGDLPSDGDDGSPSVEAAHPPITEWRLAW
FT                   "
     atgacccttg cgacatcgga aggactcgac atccgtcatg tgcgaaagcg ctatgtccag        60
     cgtggcacag cgctggatgt gctcgacgac atcacgctgc gggtccgccc cggcgaattc       120
     atcagcgtgc tcggcgcgag cggctgcggc aagtcgacct tgctgcgcct gatagcgggt       180
     ctcgataccg attacagcgg cgacattttc gttgccggcg aacgggtgcg cgacacttcg       240
     ttgcaacgcg gcatcgtgtt tcaggaccac cggctgttcc catggctcac cgcgtcgcag       300
     aatatcctgg cggcgctgcg caatgcgccg ctgacggcga agcagaagcg cgacgccgtc       360
     gctgaacaca tcgccctcgt cggcctcgcg ggcttcgaga acgcttaccc gaatcagttg       420
     tcgggtggca tggcgcagcg cgtggcgatt gctcgcgggc tggtcaaccg gccgcgtgtg       480
     ctgctgctcg acgagccatt cggcgcgctc gacgcgctca cccgtggccg cctgcaaaac       540
     gaattgcagc gcatctggga acaggaacgc atcacgatga ttctcgtcac gcacgacgtg       600
     gacgaggccg tttatctcgg agaccgggtc gtgacgatgg cgccgcgccc gggccgcatc       660
     aagcgaatcg tcgacgtcgg gttgccgcgg ccgcgcaagc gcggcgacgc gcgctttctc       720
     cggctgcgcg acgaaatcgt ggcggatttc ggagagtccg gcgacctgcc gagcgacggc       780
     gacgacggct cgccatcggt cgaggccgcg cacccaccga ttaccgaatg gcggctagcg       840
     tggtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page