(data stored in ACNUC7421 zone)

EMBL: CP000272.PE134

CP000272.PE134       Location/Qualifiers
FT   CDS_pept        150312..151529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0137"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36062"
FT                   /db_xref="GOA:Q13IM7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM7"
FT                   /protein_id="ABE36062.1"
FT                   /translation="MQASLDTAAPPTLHAALAALPALARAIGEDAAQREARRELPFDRF
FT                   ALFRQSGLGLLRFPAEWGGLGGSLEDLFHVVATLAAEESNVAHALRIHYDLTEQLLLSP
FT                   RSAFNDTQIERVRQGAIFGGASTELGTSRPGEIVTALVRDGEHFRVTGKKYYSTGTAFS
FT                   DYARINVQDENDEKASIVIPVDREGVRVLDDWDGMGQRMTASGSLVLDNVQVFAHEVAT
FT                   RGYTSLAGRHGSAVRQLHLVAVAAGIVRNILADARRYVVHYGRPVLHSPAPSAREDGFV
FT                   QQVVGDLAAHSLAVDALVQQNARTLDQSANAIRSGAANAEERVLEGALATAKTQLVVSK
FT                   LALHAGERLFEIGGASATARSHNFDRHWRNLRTIFSHNPLLHKARVIGDYELNGVTTHL
FT                   TEGRVF"
     atgcaggcat ctctcgacac tgcggcgccg ccgacgcttc atgccgcact ggccgcattg        60
     ccggcgctgg cccgcgcaat cggcgaagac gccgcgcaac gggaagcacg gcgtgaactc       120
     ccgttcgacc gctttgcgtt gttccgccaa tcggggctcg gactgctgcg ttttcccgcc       180
     gagtggggcg gcctgggtgg ctcgctcgaa gatctttttc atgtcgttgc cacgctggct       240
     gccgaggagt cgaacgtcgc gcatgcgttg cgaattcatt acgacctgac cgagcaactg       300
     ttgttgtcgc cgcgctcggc gttcaacgac acccagatcg agcgcgtgcg ccagggtgca       360
     attttcggcg gtgcatcgac cgaactcggc acttcgcgcc cgggcgaaat tgtcacggca       420
     ctcgtgcgcg acggcgagca ttttcgagta acaggcaaga agtactattc gaccggcacg       480
     gcgttttcgg actatgcgcg tatcaacgtg caggatgaaa acgacgaaaa agcgtcgatc       540
     gtcattccag tagaccgtga aggcgtgcgc gtgctcgacg attgggacgg catgggtcag       600
     cgcatgacgg cgagcggcag tctcgtgctg gacaacgtac aggtgttcgc acatgaagtg       660
     gccacgcgcg gttatacgag tctcgccggc cgccacggca gtgcggtgcg gcagctgcat       720
     ctggtcgccg tggcggccgg catcgtgcgc aatattctcg ccgacgcgcg acgctacgtg       780
     gttcactacg gtcgccccgt gcttcacagc ccggcgccgt ccgcccggga agacggtttc       840
     gtgcagcagg tggtgggcga tctcgccgcg cacagcctcg cggtcgacgc gctggttcag       900
     cagaatgcgc gaacgctgga ccagtcggcg aatgcgattc gcagtggcgc cgccaacgcc       960
     gaggagcggg tgctggaagg ggcgctcgcc actgccaaga cccagctggt ggtcagcaaa      1020
     ctggcgttgc atgcgggaga gcgtctgttc gagatcggcg gcgcgtcggc taccgcacgc      1080
     tcgcataatt tcgatcgtca ctggcgcaat ctgcgcacca tcttcagtca taacccgctg      1140
     ctgcataaag cgcgggtgat cggcgactac gaattgaacg gcgtcacgac tcatctcacc      1200
     gaaggccgcg tgttctga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page