(data stored in ACNUC7421 zone)

EMBL: CP000272.PE137

CP000272.PE137       Location/Qualifiers
FT   CDS_pept        152478..154082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0140"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36065"
FT                   /db_xref="GOA:Q13IM4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM4"
FT                   /protein_id="ABE36065.1"
FT                   /translation="MAGLNRRDFLISSGAALAAASMPSLAFAQGEATAPKRGGTLNMLI
FT                   NPEPPVLVSIFQTTGPALVASSKVLEGLLAYDFDLRPKPQLATAWTVSADGLKYAFTLR
FT                   QNVKWHDGEPFTSADVAFSIDLLKAVHPRGRSTFANVTRVTTPDARTAVIELSKPAPYL
FT                   LKALSAGESPIVPKHLYASGDPLTNPHNNAPIGTGPYRFKAWTRGANIVYERNPDYWDA
FT                   GKPYIDGLVFKVIPDAAARSAAFETGALDLGGENPVPLTDLPRLTQLPQLAVETRGYRF
FT                   LEPLSEIDFNLDHPILKDLRVRQAIAHAINPQVVQRTIAYGYADLSPTPITPGSPYHDA
FT                   KITAYAFDIAGAEKLLDAAGYPRKDGGMRFGLTHDFLPYGDLYRRQADYVKSALARVGI
FT                   DVTVRSQDLPAFLKRVYADRQFDFTSIGVNTLFDPSVGVQRLYWSKNIRPGVPFSNAPH
FT                   YSNAEVDRLLESASVETDESRRVALYQQFQQIVYRDLPILNLVAPRMITLANRRVHNHT
FT                   VSAQGLEGNLADVYLSA"
     atggcaggac tgaatcgacg cgactttctg atctcatcgg gcgcggcgct cgccgcggcc        60
     agcatgccct cattggcgtt cgcacagggc gaggccaccg cgccgaagcg aggcggcacc       120
     ttgaacatgc tgatcaaccc ggagccaccg gtgctcgtgt cgatcttcca gacgacgggc       180
     cccgcactcg tcgcgagttc gaaagtgctc gagggcttgc tggcctatga tttcgatctg       240
     cggccgaagc cgcaattggc caccgcatgg acggttagcg cggacggcct gaaatatgcc       300
     tttacgctgc gtcagaacgt caaatggcat gacggcgagc cgttcacgtc ggcggacgtc       360
     gcgttttcga tcgatctgct caaagcggtg catccccgcg gtcgcagcac gttcgccaac       420
     gtgacgcgcg tcaccacgcc cgatgcgcgc accgcggtca tcgaactgtc gaagcctgcg       480
     ccatacctgt tgaaggcttt gtccgcgggc gaatcgccga tcgtgccgaa gcacctgtac       540
     gcatccggcg atccgctgac gaacccgcac aacaacgcgc cgatcggcac gggtccgtat       600
     cgtttcaagg catggacgcg cggcgccaat atcgtctatg aacgcaatcc ggactactgg       660
     gacgccggca agccgtatat cgacggcctg gtattcaagg tgatccccga cgcggccgcc       720
     cgctcggcgg ccttcgaaac cggcgcactc gatctgggcg gcgaaaatcc ggtaccgttg       780
     acggacctgc cgcgtctcac gcaattgccg caactggcgg tggaaacgcg cggctaccgc       840
     tttctcgagc ctttgtccga gatcgacttc aacctggatc acccgatcct caaggatttg       900
     cgggtgcgcc aggcgattgc tcatgcgatc aatccgcaag tcgtgcagcg cacgattgca       960
     tacggttatg cggacctgtc gcctacgccc atcacgccgg gttcgccgta tcacgatgcg      1020
     aagatcaccg cttatgcgtt cgatatcgcc ggtgcggaaa agctgctcga cgcggccggt      1080
     tatccgcgca aggatggcgg catgcgcttc ggactgacgc acgatttcct gccttacggc      1140
     gacctgtatc gccgccaggc cgactacgtg aagtcggcgc tggcgcgtgt gggcatcgac      1200
     gtgacggtgc gttcgcaaga cctgccggcg tttctgaagc gcgtctacgc ggaccgccag      1260
     ttcgacttca cgagcatcgg cgtgaacacg ctgttcgatc cgagcgtcgg ggtccagcgt      1320
     ctctactggt cgaagaacat tcgcccgggc gtgccatttt cgaatgcgcc gcactacagc      1380
     aatgccgagg tcgaccgcct gctcgaaagc gcttccgttg aaaccgacga aagcaggcgc      1440
     gtcgcgctgt accagcaatt tcagcagatc gtttatcgcg atctgccgat tctcaacctc      1500
     gtcgcgccgc gcatgatcac gctggcgaac cggcgcgtgc acaaccacac cgtatccgcg      1560
     caaggcctcg aaggcaatct cgcggatgtc tatctgagcg cgtga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page