(data stored in SCRATCH zone)

EMBL: CP000272.PE138

CP000272.PE138       Location/Qualifiers
FT   CDS_pept        154096..155076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0141"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36066"
FT                   /db_xref="GOA:Q13IM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM3"
FT                   /protein_id="ABE36066.1"
FT                   /translation="MSRSLRVGAIARRTAWQVLPTVVGIVILNFFLLKLMPGDAADVLA
FT                   GESGSATAETMQVLRAKFGLDQPVLHQLWSYLTHLSHFSLGYSPRYDMPVMQLILSRLP
FT                   NTLFLMGVALSLAIVAGVTLGAVMAHWAGKWPDRLLSVLALLFYSTPGFWIGLLAIVLF
FT                   SVHLGWLPSGGNITLGVQLHGVAYLADAAKHVLLPAATLATFFVAIYARLTRAAMLEVQ
FT                   RQDFVRTAQAKGLHPWRVTVRHVLRNALMPLTTIVGIHFGTLLGGAAVTETVFSWPGLG
FT                   RLALDAVMARDFSVLLGVLLLSSLLVIVANVLVDLLQAWLDPRIA"
     atgagccgca gtttgcgtgt cggcgcgata gcgcgacgta ccgcgtggca ggtcttgccg        60
     acggtggtcg gcatcgtgat cctgaacttc tttctgctga aactgatgcc tggcgatgcc       120
     gccgacgtgc ttgccggcga gtccggctcg gcaacggcgg aaacgatgca ggtgctgcgt       180
     gcgaagttcg ggctcgacca gccggtgctg catcagttgt ggtcgtacct gacgcatctg       240
     tcccatttca gcctgggtta ttcaccgcgt tacgacatgc ctgtgatgca actgattctg       300
     tcgcgcttgc cgaatacatt gtttctgatg ggagtggcgc tgtcgttggc gatcgtggcc       360
     ggcgtgacgc tcggcgcggt gatggcccat tgggccggca aatggccgga tcggctgctg       420
     tcggtactgg ccttgctgtt ctattcgacg ccgggcttct ggatcggtct gctggcaatc       480
     gtgctctttt cggtgcacct cggctggctg ccgagcggtg gcaacatcac actcggcgtg       540
     cagttgcatg gcgtcgccta tctcgccgat gcggcaaagc acgtgctgtt gcccgcagcg       600
     acactggcga cgtttttcgt cgcgatctat gcgcggctta ctcgtgccgc catgctcgaa       660
     gtgcagcgtc aggacttcgt gcggaccgct caggccaagg gcctgcatcc gtggcgcgtg       720
     acggtgcggc atgtgctgcg caacgcattg atgccgctga ccaccatcgt cgggattcat       780
     ttcggtacgc tgctgggcgg cgcggcggtg acggagaccg tgttcagctg gccgggcctc       840
     ggacgccttg cgctcgacgc ggtgatggcg cgcgatttca gcgtgctgct cggcgtgctg       900
     ctgctgtcgt cgctgctcgt gatcgtcgcg aatgtcctcg tcgatctgct gcaggcctgg       960
     ctcgatccac gcattgcgtg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page