(data stored in ACNUC7421 zone)

EMBL: CP000272.PE139

CP000272.PE139       Location/Qualifiers
FT   CDS_pept        155141..156112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0142"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36067"
FT                   /db_xref="GOA:Q13IM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM2"
FT                   /protein_id="ABE36067.1"
FT                   /translation="MASDSPDLISSSPEPGASSWRRQLAGTLFGQRRAGAARAPGPQRT
FT                   GRGVWRALLRNPSALAGLVLFTAFIALALGAGHLFPGDPLDMVAAPFEWPGADPQYWLG
FT                   TDSLGRDVAAGIAHGTRVSLLIGAAAAAIGLVIGTLVGAAGGFFGGVVDNVLVRVTELF
FT                   QTIPSFLLVIVIVAIGRPGVTVIALAIGIASWPTVARIVRAEFRTLREADFVLAARSQG
FT                   FSNARIIFGEILPNALPPVIVTASVMVASAILIESSLSFLGMGDPNVVSWGGMIGAGRD
FT                   SLRTAWYLTAIPGTAIVVAVLSLNLLGDGLNDALNPRLRERT"
     atggcttccg actctcccga tctgatctcc agctcgcctg agccgggtgc ttcttcgtgg        60
     cggcggcaac tggccggcac gctgttcggt cagcgccgcg ccggcgcggc acgcgcgccc       120
     ggcccgcagc ggacggggcg cggcgtgtgg cgcgcgctgc tgcgcaatcc gtcggcgctc       180
     gcggggctcg tgctgttcac cgcgttcatc gcgctcgcgc tcggtgcggg gcatctgttt       240
     cctggcgacc cactcgatat ggtcgcggct cccttcgaat ggccgggcgc tgatccgcag       300
     tactggctcg gcaccgattc gctcgggcgc gatgtggctg caggcattgc gcatggcacg       360
     cgcgtgtcgc tgctgatcgg cgcggcggcg gcggcaatcg ggctcgtgat cggcacgctg       420
     gtcggcgcgg cggggggctt cttcggcgga gtggtcgaca acgtgctggt gcgcgtcacc       480
     gaactctttc aaaccattcc gtcgtttctg ctggtaatcg tcattgttgc cattggccgg       540
     ccgggcgtga cggttatcgc gctggccatc ggcatcgcgt cgtggccgac cgtcgcgcgg       600
     atcgtgcgcg ccgaattccg taccctgcgc gaggcggact tcgtgctcgc ggcgcgtagc       660
     caggggttca gcaacgcacg catcatcttc ggcgaaattt tgccgaatgc gttgccaccg       720
     gtgatcgtca ccgcgtcggt catggtggcg agcgccatcc tgatcgagtc gtcgctgtcg       780
     tttctcggca tgggcgaccc gaacgtcgtc agctggggcg gaatgatcgg cgcgggccgg       840
     gattcgttgc gcaccgcgtg gtatctgacc gcaattcccg gcacggcgat cgtcgtcgcg       900
     gtgctctcgc tgaatctgct cggcgacggc ctgaacgacg cgctcaatcc gcgtttgcgg       960
     gaacgcacct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page