(data stored in SCRATCH zone)

EMBL: CP000272.PE142

CP000272.PE142       Location/Qualifiers
FT   CDS_pept        complement(158781..159131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36070"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL9"
FT                   /protein_id="ABE36070.1"
FT                   /translation="MEYRQLGCCGIKVSTLTLGTMMFGSPTDEAAAARIIDLAHEQRIN
FT                   RRLQQTEWRTEAQWHDYLPALCYRLTAEDTAFVDSLVASGQPSTPEFNDPGRPFCGRIA
FT                   RRGAPQDEPYCA"
     atggaataca gacagctcgg ctgctgcggt atcaaggtct cgacattgac gctcggcacg        60
     atgatgttcg gcagccccac cgacgaagcc gctgccgccc gcatcatcga cctggctcac       120
     gagcagcgca tcaaccggcg gctgcagcaa accgaatggc gcaccgaggc gcaatggcac       180
     gactacctgc cggccttgtg ttaccggctc actgccgaag acacagcgtt tgtcgattcg       240
     ctcgtcgcga gcggccagcc gtcgacgccg gaattcaacg acccgggccg tccgttctgt       300
     ggccggattg cgcgccgcgg tgcgccgcag gacgagccct attgcgctta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page