(data stored in ACNUC7421 zone)

EMBL: CP000272.PE144

CP000272.PE144       Location/Qualifiers
FT   CDS_pept        complement(160830..161894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0147"
FT                   /product="Putative desulfurizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36072"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL7"
FT                   /protein_id="ABE36072.1"
FT                   /translation="MSRIWYTRCPAPTPFGIAAQKGWLQQEFAADGIDVKALQDADDVL
FT                   VRRSHFTHSQPWSFRQGGNIPALWARAQGSDTRLIGLSWVDEFQALITLDRQLDATPHA
FT                   LAGRRFGFPRSTRAGGVVDFHRATALRGFSSLLNALGVQFEDIDFVELPHTPRGLDGAK
FT                   PAGDAPLDAWLDAQRSHEFARETEALLRGEADVVFVKGATGLDITNLLNAKILIEIGAQ
FT                   PNRALHANNGTPRPLTVDAQLLRERPDLVERVLARTLAAGDWAQGHVAELASYVGREVR
FT                   SAEHWVERAYPGGLHRQLTIGLDPHALAALSDFKRFLFKWGFIATDFDFDAWVEPAPLA
FT                   AALERRRAFAVSTA"
     atgagccgaa tctggtacac acgctgcccc gcacccaccc cgttcggcat cgcggcgcaa        60
     aaaggttggc tacagcagga gttcgcggcc gacggcatcg acgtcaaggc attgcaggat       120
     gctgacgacg tgctggtccg ccgttctcat ttcacgcata gccagccgtg gtcgtttcgg       180
     caaggcggca atatcccggc gctatgggcg cgtgctcaag gcagcgacac gcgcctgatc       240
     ggcctgagct gggtcgacga gttccaggcg ttgatcacgc tcgaccggca actcgacgcc       300
     acgcctcacg cgctcgccgg acgccgcttc ggatttccgc gcagcacccg ggcggggggc       360
     gtggtggact ttcaccgcgc caccgcgctg cgcgggttct cgtcgctgct caatgcgctc       420
     ggcgtgcagt tcgaagatat cgactttgtc gaattgccgc acacgcctcg cggactcgac       480
     ggcgcgaagc ccgccggcga cgcaccgctg gacgcgtggc tcgacgctca gcgttcgcat       540
     gagttcgccc gcgaaaccga ggcgcttctg cgcggtgagg ccgatgtcgt gttcgtcaaa       600
     ggcgcgaccg gactggatat taccaacctg ctcaacgcga aaatcctcat cgagatcggc       660
     gcgcaaccca atcgcgcgtt gcatgcgaac aatggtacgc cgcgaccgct gaccgtcgac       720
     gcgcaactgt tgcgtgaacg tcccgacctg gtcgaacgcg tactggcgcg cacgctcgcc       780
     gccggcgact gggcccaggg ccacgttgcc gagctcgcga gttatgtcgg ccgggaggtt       840
     cgcagcgccg agcattgggt cgaacgcgcg tatccgggtg gtctgcaccg gcagttgaca       900
     ataggcctcg atccacacgc gctggccgcc ctttccgact tcaagcgctt cctgttcaag       960
     tggggtttca tcgcgacgga tttcgacttc gatgcatggg tcgagccggc tccgctcgcg      1020
     gcggcacttg agcgacgccg ggcgttcgct gtgtcgacag cttga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page