(data stored in ACNUC7421 zone)

EMBL: CP000272.PE146

CP000272.PE146       Location/Qualifiers
FT   CDS_pept        complement(163366..163680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36074"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL5"
FT                   /protein_id="ABE36074.1"
FT                   /translation="MNGPIVWSVEVSGTSYEWQRRETHNFMNLVWPARLHRRCIEPSVG
FT                   SHQAFRFICMNQRISASNRSAAISGSRQERQYGFPTGSRGNLSCRADPHKYAGQIRRFR
FT                   "
     ttgaatggtc cgatcgtctg gtcagtcgaa gttagcggta cgagctatga atggcaacga        60
     agggaaactc ataactttat gaacctcgta tggccggcac gtttgcatcg ccgatgcatt       120
     gaaccgtcgg ttggatcgca tcaggcgttc cgctttatct gcatgaatca gcgcatcagc       180
     gcatcgaacc ggtctgcagc gatcagcggc tcgcgtcagg aacgccaata tggcttcccg       240
     accggctccc gcgggaacct ttcatgcaga gccgatccac acaaatacgc cggacagatc       300
     cgtcgtttca gataa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page