(data stored in ACNUC7421 zone)

EMBL: CP000272.PE151

CP000272.PE151       Location/Qualifiers
FT   CDS_pept        168286..169338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0154"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36079"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL0"
FT                   /protein_id="ABE36079.1"
FT                   /translation="MLARFRSTATRSSFGRRFTAALLTFSMGVAGFAATAPAHAEGQIR
FT                   VAEQFGIVYLLLNVARDQQFVEKEGRKQGLDIKVDWVKLSGGAAVNDALLSGAVDIAGA
FT                   GVGPLLTIWDRTRGKQNVKGVASLGNLPYYLISNDPNVRTIADFTEKDRIAVPAVNVSV
FT                   QSRVLQYAAAKRWGDKDYNRLDKFTQALPHPDAAAAIIAGGTEITGHFGNPPFQEQELA
FT                   GNPKAHIVLNSYDVLGGPSSATVLYATEKFRDNNPKTYRAFVDALADAARFITANPDAA
FT                   ADIYIRTNQSKIDRNLLVKVIKNPQVQFKVAPQNTFGLAQFMYRVGAIKNEPKSWKDYF
FT                   FDDPATAAGS"
     atgcttgcca ggtttcgctc gaccgccacg cggtcgtcgt ttggccgccg tttcaccgcg        60
     gcgctgctga ctttctcgat gggcgtcgcg ggctttgccg ccactgcacc cgcgcatgcc       120
     gaagggcaga tccgcgtggc cgagcagttc ggcattgtct atctgctgct gaacgtggcg       180
     cgcgaccagc agttcgtcga gaaagaaggg cgtaagcagg ggctcgacat caaggtcgac       240
     tgggtgaagc tctcgggcgg cgcggcggtc aacgacgcgc tgctgtccgg cgcggtggac       300
     atcgccggcg cgggcgtcgg gccgttgctg acgatctggg accgcacgcg cggcaagcag       360
     aacgtcaagg gcgtcgcctc gctcggcaat ctgccgtatt acctcatcag caacgatccc       420
     aatgtcagga cgattgccga cttcacggag aaggaccgca tcgcggtgcc ggctgtgaac       480
     gtttcggtgc aatcgcgcgt gctgcaatat gcggcggcca aacgctgggg cgacaaggat       540
     tacaaccggc tcgacaagtt cacccaggcg ttgccgcatc ccgatgcggc tgcggcgatc       600
     attgccggcg gtacggaaat taccggccac ttcggcaatc cgccatttca ggagcaggaa       660
     ctggcgggca atccgaaggc gcatatcgtg ctgaattcgt acgatgtgct gggcggcccg       720
     agttcggcga ccgtgcttta cgcaaccgag aaattccgcg acaacaatcc gaagacgtac       780
     cgcgcattcg tcgatgcgct ggccgacgcc gcgcgcttca ttacggcaaa tccggatgcg       840
     gccgccgata tctacattcg cacgaatcaa tcgaaaatcg accgcaatct gctcgtgaag       900
     gtgatcaaga acccgcaggt gcagttcaag gtcgcgccgc agaacacgtt cgggctcgcg       960
     cagttcatgt atcgcgtcgg cgcgatcaaa aacgaaccga agtcgtggaa agattacttc      1020
     ttcgacgacc cggcgaccgc ggcggggagt tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page