(data stored in ACNUC7421 zone)

EMBL: CP000272.PE154

CP000272.PE154       Location/Qualifiers
FT   CDS_pept        complement(171379..172203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0157"
FT                   /product="ABC methionine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36082"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK7"
FT                   /protein_id="ABE36082.1"
FT                   /translation="MKGQKIIGSVLATLILGWGIVASPLSHAADQTVRVGIMSGEDEDV
FT                   WRVVAANAAKHGLLVKTTTFNDYTQPNAALSQHDLDANSFQHKPYLDAQIAARGYRIIP
FT                   VGYTYVQPIGLYSRKVKSVADLPTGATIGVPNDPSNEGRSLLLLQAQGLITLRPDVGLL
FT                   PTVRDIANNPKNIHIKELDAGIVGRAIGDLDAAVINTDWAIKAGIKIPQERIAQEKVAG
FT                   NPYRNFIAVNENDQKAPWVHALVESYQEPNVAAEILRVYHGATLPAWNESPK"
     atgaaagggc aaaagatcat tggaagcgtg ctggccacgc tgatactcgg ctggggcatt        60
     gtggcgtcgc cgctatccca cgctgcggat cagaccgtgc gcgtcggcat catgtccggg       120
     gaagacgaag acgtctggcg cgtggtcgcc gcaaacgcgg caaagcacgg cctgttggta       180
     aagacgacga cgttcaacga ctatacgcaa cccaatgcgg cgttgtccca gcacgatctg       240
     gatgcaaatt ccttccagca caagccttat ctcgatgcac agattgccgc gcgcggctat       300
     cgcatcatcc cggtgggtta tacctacgtt cagccgatcg gcctgtattc gcgcaaggtg       360
     aaatcggtgg ctgacttgcc gaccggcgcg accatcggcg tgccgaatga cccgagcaac       420
     gaaggccgct cacttctcct gcttcaggcc cagggcctga tcacgctacg tccggacgtg       480
     gggctccttc ccaccgtgcg cgatatcgcg aacaatccga aaaacatcca catcaaggaa       540
     ctcgacgcgg gtatcgtcgg gcgcgcaatc ggcgatctgg acgcagccgt catcaacacc       600
     gactgggcca tcaaggccgg catcaaaatc cctcaggaac ggatcgcgca ggaaaaggtc       660
     gcaggcaatc cttatcgcaa cttcatcgcc gtgaatgaaa acgaccagaa agcgccgtgg       720
     gtccacgctc tggtcgaaag ttatcaggag cctaacgtcg ctgcggagat cctccgggtg       780
     tatcacggag cgacgctgcc agcctggaat gaatcaccca aatga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page