(data stored in SCRATCH zone)

EMBL: CP000272.PE156

CP000272.PE156       Location/Qualifiers
FT   CDS_pept        complement(172810..173814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0159"
FT                   /product="ABC aliphatic sulfonates transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36084"
FT                   /db_xref="GOA:Q13IK5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK5"
FT                   /protein_id="ABE36084.1"
FT                   /translation="MTLMTRRAFTRAMLAAALTITGTQGHAQASRTAGSPVALRIGYQK
FT                   SSTLITLLKARGSLEQALAPLGVNVSWHEFASGLPLTEALNVDAVDFSADVADTVPVFA
FT                   QAAHANFVYIAQEAPSPGAQAIIVRKDGPLHTLADLKGKHIAVTKAAGSHYLLLAALAK
FT                   AGLSPADVTIHYLAPADGRAAFEHGSVDAWITWDPYVASVDRDTSVRILADGNGLASYQ
FT                   RYYLASSNFAAAHPAVIQILFDQLSQAGTWLRTHPEDAAKTLSPIWGLDTTTIERANAR
FT                   RSYVVRPVVPQNFSEQQKIADTFLQAGLLPARVDTGEAQRWDFATKRAEPAGS"
     atgacgttaa tgacgcggcg cgcttttacg cgcgccatgc tggctgccgc actgaccatc        60
     accggcacgc agggccatgc ccaggcatcg cgaacggccg ggtctcccgt cgccttgcgt       120
     atcggctacc agaaatcgtc gacgctaatc acgctgctca aggcgcgcgg ctcgctggaa       180
     caggcgctcg cgccgctcgg cgtgaacgtc tcgtggcacg aattcgcaag tggcctgccg       240
     cttaccgaag cgcttaacgt cgatgcggtc gacttcagcg ccgacgtcgc ggatacggtg       300
     ccggtcttcg cccaggccgc gcatgcgaac ttcgtctata tcgcgcagga agcgccgtcg       360
     ccgggcgctc aggcaatcat cgtaagaaaa gacggtccgc tgcacacgct ggccgacctg       420
     aaaggcaagc acatcgcggt aacgaaggcg gcgggaagcc actatctgtt gctcgccgcg       480
     ctcgccaaag ccggcctttc tccggcagac gtgacgatcc actacctcgc gccggcggac       540
     gggcgggcgg cgttcgagca tggcagcgtc gacgcctgga tcacatggga tccgtatgtc       600
     gcttcggtcg acagagacac cagcgtgcgc attctcgcgg acggcaacgg actcgcgtcg       660
     tatcagcgtt actacctcgc ttcgagcaat ttcgccgcgg cgcaccccgc agtcattcag       720
     atcctgttcg accagttgtc tcaggcgggc acgtggctgc gcacgcatcc cgaggatgcc       780
     gcgaaaacgc tctcgccgat ctggggactc gataccacga caatcgagcg ggcgaatgcg       840
     cgccgcagtt atgtggtgcg acccgtcgtc ccgcagaatt tcagcgaaca gcagaagatc       900
     gccgatacgt tcctgcaggc cggcctgctg ccggcacgcg tggatacggg cgaagcacag       960
     cgatgggatt tcgccacgaa gcgcgcggaa cccgccggga gctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page