(data stored in SCRATCH zone)

EMBL: CP000272.PE159

CP000272.PE159       Location/Qualifiers
FT   CDS_pept        complement(177326..177829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0162"
FT                   /product="flavin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36087"
FT                   /db_xref="GOA:Q13IK2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK2"
FT                   /protein_id="ABE36087.1"
FT                   /translation="MSNGIADLFRHLTAGVYVIGVADGDRRNAFTASSIMQISFSPLLL
FT                   AISISPAHESYALLGGGRVFSINVLGEQQQALARHFGTQSGRTVDKLASIPWRPGKSGA
FT                   PLLRDALAHFDCRVVSDIEAGDHRLVVGRVIDGTVVSPHGRPLIYAQTGNMDMSASLFP
FT                   PDFS"
     atgagcaacg gcatcgcaga tcttttcaga catttgaccg cgggcgtgta tgtcatcggc        60
     gtagcggacg gtgatcgcag gaatgcattc actgcgagtt cgatcatgca gatttcattt       120
     tccccattgc ttctggcgat cagtatcagt ccggcacacg agtcttatgc acttcttggc       180
     ggcggccggg tgttctcgat caatgtgctg ggcgaacaac aacaggcgct cgccaggcac       240
     ttcgggaccc aatcgggccg caccgtcgac aaactggcgt cgataccctg gcggcccggc       300
     aaatcgggcg caccgctgtt gcgcgacgcg ctggctcact tcgactgccg ggtggtcagc       360
     gacatcgagg ccggtgatca tcggctagtg gtggggcgcg tgatcgacgg aacggtggtc       420
     agcccgcatg ggcgccccct gatctacgca cagaccggca acatggacat gagcgccagt       480
     ctcttcccgc cggacttttc ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page